Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
| Location | 60472..60997 | Replicon | plasmid pWSM1274_2 |
| Accession | NZ_CP104140 | ||
| Organism | Rhizobium leguminosarum bv. viciae strain WSM1274 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | N2600_RS30025 | Protein ID | WP_260299627.1 |
| Coordinates | 60725..60997 (+) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | N2600_RS30020 | Protein ID | WP_260111936.1 |
| Coordinates | 60472..60723 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2600_RS30010 (N2600_30010) | 57153..58496 | - | 1344 | WP_260111934.1 | adenylate/guanylate cyclase domain-containing protein | - |
| N2600_RS30015 (N2600_30015) | 59001..60338 | + | 1338 | WP_260299626.1 | nucleotide sugar dehydrogenase | - |
| N2600_RS30020 (N2600_30020) | 60472..60723 | + | 252 | WP_260111936.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| N2600_RS30025 (N2600_30025) | 60725..60997 | + | 273 | WP_260299627.1 | Txe/YoeB family addiction module toxin | Toxin |
| N2600_RS30030 (N2600_30030) | 61052..62227 | - | 1176 | WP_162115193.1 | DUF3095 domain-containing protein | - |
| N2600_RS30035 (N2600_30035) | 62452..62931 | + | 480 | WP_260299628.1 | class I SAM-dependent methyltransferase | - |
| N2600_RS30040 (N2600_30040) | 63057..64847 | - | 1791 | WP_260299629.1 | ABC transporter ATP-binding protein | - |
| N2600_RS30045 (N2600_30045) | 65263..65718 | - | 456 | WP_222386857.1 | Rrf2 family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..423083 | 423083 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10820.46 Da Isoelectric Point: 8.4756
>T257332 WP_260299627.1 NZ_CP104140:60725-60997 [Rhizobium leguminosarum bv. viciae]
MKLLWTPNSWEEYEYWQKSDQKMVEKINELLKDTKRSPFKVLGKPEPLKGDLSGFWSRRILGEHRLVYCVTGKGSDQELE
IIQCRFHYEK
MKLLWTPNSWEEYEYWQKSDQKMVEKINELLKDTKRSPFKVLGKPEPLKGDLSGFWSRRILGEHRLVYCVTGKGSDQELE
IIQCRFHYEK
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|