Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2652021..2652639 | Replicon | plasmid pC101a |
| Accession | NZ_CP104135 | ||
| Organism | Sinorhizobium sp. C101 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N0R80_RS15610 | Protein ID | WP_275597441.1 |
| Coordinates | 2652343..2652639 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N0R80_RS15605 | Protein ID | WP_100671964.1 |
| Coordinates | 2652021..2652329 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0R80_RS15580 (N0R80_15580) | 2647337..2648320 | + | 984 | WP_018095868.1 | ABC transporter ATP-binding protein | - |
| N0R80_RS15585 (N0R80_15585) | 2648317..2649321 | + | 1005 | WP_275597443.1 | ABC transporter ATP-binding protein | - |
| N0R80_RS15590 (N0R80_15590) | 2649402..2650079 | - | 678 | WP_018095870.1 | GntR family transcriptional regulator | - |
| N0R80_RS15595 (N0R80_15595) | 2650214..2650837 | + | 624 | WP_018095871.1 | flavin reductase family protein | - |
| N0R80_RS15600 (N0R80_15600) | 2650869..2651594 | + | 726 | WP_275597442.1 | aspartate/glutamate racemase family protein | - |
| N0R80_RS15605 (N0R80_15605) | 2652021..2652329 | - | 309 | WP_100671964.1 | HigA family addiction module antitoxin | Antitoxin |
| N0R80_RS15610 (N0R80_15610) | 2652343..2652639 | - | 297 | WP_275597441.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N0R80_RS15615 (N0R80_15615) | 2652884..2653864 | - | 981 | WP_275597440.1 | LysR family transcriptional regulator | - |
| N0R80_RS15620 (N0R80_15620) | 2653970..2654934 | + | 965 | Protein_2532 | MBL fold metallo-hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | kdsB / adeG / adeG / fliQ / flhA / icl / htpB / acpXL / tufA / tufA / kdsA / acpXL / pgm | 1..3521547 | 3521547 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11686.09 Da Isoelectric Point: 5.6246
>T257316 WP_275597441.1 NZ_CP104135:c2652639-2652343 [Sinorhizobium sp. C101]
MIVGFRDDWLRAFFVDDAHSRNIPSDLEVRLFRKLQMIDDATTDQDLRVPPSNFFEKLRGNLAGFHSIRVNQQWRLIFRW
DGERGEADGIYLDDHSYR
MIVGFRDDWLRAFFVDDAHSRNIPSDLEVRLFRKLQMIDDATTDQDLRVPPSNFFEKLRGNLAGFHSIRVNQQWRLIFRW
DGERGEADGIYLDDHSYR
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|