Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 425689..426307 | Replicon | plasmid pK101a |
| Accession | NZ_CP104131 | ||
| Organism | Sinorhizobium sp. K101 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N0Q91_RS04670 | Protein ID | WP_275597441.1 |
| Coordinates | 425689..425985 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N0Q91_RS04675 | Protein ID | WP_100671964.1 |
| Coordinates | 425999..426307 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0Q91_RS04660 (N0Q91_04660) | 423394..424358 | - | 965 | Protein_378 | MBL fold metallo-hydrolase | - |
| N0Q91_RS04665 (N0Q91_04665) | 424464..425444 | + | 981 | WP_275597440.1 | LysR family transcriptional regulator | - |
| N0Q91_RS04670 (N0Q91_04670) | 425689..425985 | + | 297 | WP_275597441.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N0Q91_RS04675 (N0Q91_04675) | 425999..426307 | + | 309 | WP_100671964.1 | HigA family addiction module antitoxin | Antitoxin |
| N0Q91_RS04680 (N0Q91_04680) | 426733..427458 | - | 726 | WP_275597442.1 | aspartate/glutamate racemase family protein | - |
| N0Q91_RS04685 (N0Q91_04685) | 427490..428113 | - | 624 | WP_018095871.1 | flavin reductase family protein | - |
| N0Q91_RS04690 (N0Q91_04690) | 428248..428925 | + | 678 | WP_018095870.1 | GntR family transcriptional regulator | - |
| N0Q91_RS04695 (N0Q91_04695) | 429006..430010 | - | 1005 | WP_275597443.1 | ABC transporter ATP-binding protein | - |
| N0Q91_RS04700 (N0Q91_04700) | 430007..430990 | - | 984 | WP_018095868.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pgm / acpXL / kdsA / tufA / tufA / acpXL / htpB / icl / fliQ / adeG / kdsB | 1..3521393 | 3521393 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11686.09 Da Isoelectric Point: 5.6246
>T257300 WP_275597441.1 NZ_CP104131:425689-425985 [Sinorhizobium sp. K101]
MIVGFRDDWLRAFFVDDAHSRNIPSDLEVRLFRKLQMIDDATTDQDLRVPPSNFFEKLRGNLAGFHSIRVNQQWRLIFRW
DGERGEADGIYLDDHSYR
MIVGFRDDWLRAFFVDDAHSRNIPSDLEVRLFRKLQMIDDATTDQDLRVPPSNFFEKLRGNLAGFHSIRVNQQWRLIFRW
DGERGEADGIYLDDHSYR
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|