Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2651994..2652612 | Replicon | plasmid pM103a |
Accession | NZ_CP104127 | ||
Organism | Sinorhizobium sp. M103 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N0Q90_RS15635 | Protein ID | WP_275597441.1 |
Coordinates | 2652316..2652612 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N0Q90_RS15630 | Protein ID | WP_100671964.1 |
Coordinates | 2651994..2652302 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0Q90_RS15605 (N0Q90_15605) | 2647309..2648293 | + | 985 | Protein_2524 | ABC transporter ATP-binding protein | - |
N0Q90_RS15610 (N0Q90_15610) | 2648290..2649294 | + | 1005 | WP_275597443.1 | ABC transporter ATP-binding protein | - |
N0Q90_RS15615 (N0Q90_15615) | 2649375..2650052 | - | 678 | WP_018095870.1 | GntR family transcriptional regulator | - |
N0Q90_RS15620 (N0Q90_15620) | 2650187..2650810 | + | 624 | WP_018095871.1 | flavin reductase family protein | - |
N0Q90_RS15625 (N0Q90_15625) | 2650842..2651567 | + | 726 | WP_275597442.1 | aspartate/glutamate racemase family protein | - |
N0Q90_RS15630 (N0Q90_15630) | 2651994..2652302 | - | 309 | WP_100671964.1 | HigA family addiction module antitoxin | Antitoxin |
N0Q90_RS15635 (N0Q90_15635) | 2652316..2652612 | - | 297 | WP_275597441.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N0Q90_RS15640 (N0Q90_15640) | 2652857..2653837 | - | 981 | WP_275597440.1 | LysR family transcriptional regulator | - |
N0Q90_RS15645 (N0Q90_15645) | 2653943..2654907 | + | 965 | Protein_2532 | MBL fold metallo-hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | kdsB / adeG / fliE / fliQ / flhA / icl / htpB / acpXL / tufA / tufA / kdsA / acpXL / pgm | 1..3521513 | 3521513 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11686.09 Da Isoelectric Point: 5.6246
>T257290 WP_275597441.1 NZ_CP104127:c2652612-2652316 [Sinorhizobium sp. M103]
MIVGFRDDWLRAFFVDDAHSRNIPSDLEVRLFRKLQMIDDATTDQDLRVPPSNFFEKLRGNLAGFHSIRVNQQWRLIFRW
DGERGEADGIYLDDHSYR
MIVGFRDDWLRAFFVDDAHSRNIPSDLEVRLFRKLQMIDDATTDQDLRVPPSNFFEKLRGNLAGFHSIRVNQQWRLIFRW
DGERGEADGIYLDDHSYR
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|