Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4581709..4582311 | Replicon | chromosome |
| Accession | NZ_CP104123 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-49610 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | N1705_RS22020 | Protein ID | WP_000897305.1 |
| Coordinates | 4582000..4582311 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N1705_RS22015 | Protein ID | WP_000356397.1 |
| Coordinates | 4581709..4581999 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1705_RS21990 (4577654) | 4577654..4578556 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| N1705_RS21995 (4578553) | 4578553..4579188 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N1705_RS22000 (4579185) | 4579185..4580114 | + | 930 | WP_032359289.1 | formate dehydrogenase accessory protein FdhE | - |
| N1705_RS22005 (4580444) | 4580444..4580686 | - | 243 | WP_001086388.1 | protein YiiF | - |
| N1705_RS22010 (4580905) | 4580905..4581123 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| N1705_RS22015 (4581709) | 4581709..4581999 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| N1705_RS22020 (4582000) | 4582000..4582311 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| N1705_RS22025 (4582540) | 4582540..4583448 | + | 909 | WP_044722469.1 | alpha/beta hydrolase | - |
| N1705_RS22030 (4583616) | 4583616..4584530 | - | 915 | WP_260248703.1 | transposase | - |
| N1705_RS22035 (4584543) | 4584543..4585430 | - | 888 | Protein_4304 | hypothetical protein | - |
| N1705_RS22040 (4585845) | 4585845..4586786 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| N1705_RS22045 (4586831) | 4586831..4587268 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T257284 WP_000897305.1 NZ_CP104123:c4582311-4582000 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|