Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2499358..2499996 | Replicon | chromosome |
Accession | NZ_CP104123 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-49610 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N1705_RS12035 | Protein ID | WP_000813794.1 |
Coordinates | 2499820..2499996 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N1705_RS12030 | Protein ID | WP_001270286.1 |
Coordinates | 2499358..2499774 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1705_RS12010 (2494510) | 2494510..2495451 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
N1705_RS12015 (2495452) | 2495452..2496465 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
N1705_RS12020 (2496483) | 2496483..2497628 | - | 1146 | WP_000047429.1 | ABC transporter substrate-binding protein | - |
N1705_RS12025 (2497873) | 2497873..2499279 | - | 1407 | WP_219411894.1 | PLP-dependent aminotransferase family protein | - |
N1705_RS12030 (2499358) | 2499358..2499774 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N1705_RS12035 (2499820) | 2499820..2499996 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N1705_RS12040 (2500218) | 2500218..2500448 | + | 231 | WP_000494244.1 | YncJ family protein | - |
N1705_RS12045 (2500540) | 2500540..2502501 | - | 1962 | WP_147699513.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N1705_RS12050 (2502574) | 2502574..2503110 | - | 537 | WP_219411944.1 | DNA-binding transcriptional regulator SutR | - |
N1705_RS12055 (2503163) | 2503163..2504377 | + | 1215 | WP_260248478.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2504417..2505565 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T257277 WP_000813794.1 NZ_CP104123:c2499996-2499820 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT257277 WP_001270286.1 NZ_CP104123:c2499774-2499358 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|