Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1196780..1197507 | Replicon | chromosome |
| Accession | NZ_CP104123 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-49610 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q3YYE6 |
| Locus tag | N1705_RS05820 | Protein ID | WP_000547563.1 |
| Coordinates | 1196780..1197091 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N1705_RS05825 | Protein ID | WP_000126296.1 |
| Coordinates | 1197088..1197507 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1705_RS05790 (1191922) | 1191922..1193631 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
| N1705_RS05795 (1193641) | 1193641..1194183 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
| N1705_RS05800 (1194183) | 1194183..1194950 | + | 768 | WP_000067401.1 | formate hydrogenlyase subunit HycG | - |
| N1705_RS05805 (1194947) | 1194947..1195357 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| N1705_RS05810 (1195350) | 1195350..1195820 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| N1705_RS05815 (1195845) | 1195845..1196618 | + | 774 | WP_001026444.1 | hypothetical protein | - |
| N1705_RS05820 (1196780) | 1196780..1197091 | + | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N1705_RS05825 (1197088) | 1197088..1197507 | + | 420 | WP_000126296.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N1705_RS05830 (1197621) | 1197621..1199045 | - | 1425 | WP_000110319.1 | 6-phospho-beta-glucosidase AscB | - |
| N1705_RS05835 (1199054) | 1199054..1200511 | - | 1458 | WP_187186628.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| N1705_RS05840 (1200771) | 1200771..1201781 | + | 1011 | WP_001343660.1 | DNA-binding transcriptional regulator AscG | - |
| N1705_RS05845 (1201930) | 1201930..1202457 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T257269 WP_000547563.1 NZ_CP104123:1196780-1197091 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.38 Da Isoelectric Point: 4.3653
>AT257269 WP_000126296.1 NZ_CP104123:1197088-1197507 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNQEFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNQEFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|