Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 709578..710305 | Replicon | chromosome |
Accession | NZ_CP104123 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-49610 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | N1705_RS03460 | Protein ID | WP_000550189.1 |
Coordinates | 709578..709892 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N1705_RS03465 | Protein ID | WP_000560266.1 |
Coordinates | 709889..710305 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1705_RS03440 (705744) | 705744..706730 | - | 987 | WP_032206007.1 | Gfo/Idh/MocA family oxidoreductase | - |
N1705_RS03445 (706809) | 706809..707492 | - | 684 | WP_001183054.1 | vancomycin high temperature exclusion protein | - |
N1705_RS03450 (707569) | 707569..708072 | - | 504 | WP_001297151.1 | M48 family metallopeptidase | - |
N1705_RS03455 (708157) | 708157..709293 | + | 1137 | WP_000018681.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
N1705_RS03460 (709578) | 709578..709892 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
N1705_RS03465 (709889) | 709889..710305 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
N1705_RS03470 (710350) | 710350..712368 | - | 2019 | WP_219411614.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
N1705_RS03475 (712794) | 712794..715145 | - | 2352 | WP_219411615.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T257265 WP_000550189.1 NZ_CP104123:709578-709892 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT257265 WP_000560266.1 NZ_CP104123:709889-710305 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|