Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4763124..4763726 | Replicon | chromosome |
Accession | NZ_CP104117 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-50748 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | N1709_RS23195 | Protein ID | WP_000897305.1 |
Coordinates | 4763415..4763726 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N1709_RS23190 | Protein ID | WP_000356397.1 |
Coordinates | 4763124..4763414 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1709_RS23165 (4759049) | 4759049..4759951 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
N1709_RS23170 (4759948) | 4759948..4760583 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
N1709_RS23175 (4760580) | 4760580..4761509 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
N1709_RS23180 (4761839) | 4761839..4762081 | - | 243 | WP_001087409.1 | protein YiiF | - |
N1709_RS23185 (4762301) | 4762301..4762519 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
N1709_RS23190 (4763124) | 4763124..4763414 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
N1709_RS23195 (4763415) | 4763415..4763726 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
N1709_RS23200 (4763955) | 4763955..4764863 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
N1709_RS23205 (4764927) | 4764927..4765868 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
N1709_RS23210 (4765913) | 4765913..4766350 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
N1709_RS23215 (4766347) | 4766347..4767219 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
N1709_RS23220 (4767213) | 4767213..4767812 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
N1709_RS23225 (4767911) | 4767911..4768696 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T257258 WP_000897305.1 NZ_CP104117:c4763726-4763415 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|