Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2863186..2863406 Replicon chromosome
Accession NZ_CP104117
Organism Escherichia coli strain USDA-ARS-USMARC-50748

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag N1709_RS14145 Protein ID WP_000170965.1
Coordinates 2863299..2863406 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2863186..2863252 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N1709_RS14120 2858465..2859859 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
N1709_RS14125 2860044..2860397 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
N1709_RS14130 2860441..2861136 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
N1709_RS14135 2861294..2861524 - 231 WP_001146442.1 putative cation transport regulator ChaB -
N1709_RS14140 2861794..2862894 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2863186..2863252 - 67 - - Antitoxin
N1709_RS14145 2863299..2863406 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2863719..2863782 - 64 NuclAT_33 - -
- 2863719..2863782 - 64 NuclAT_33 - -
- 2863719..2863782 - 64 NuclAT_33 - -
- 2863719..2863782 - 64 NuclAT_33 - -
- 2863719..2863782 - 64 NuclAT_35 - -
- 2863719..2863782 - 64 NuclAT_35 - -
- 2863719..2863782 - 64 NuclAT_35 - -
- 2863719..2863782 - 64 NuclAT_35 - -
- 2863719..2863782 - 64 NuclAT_37 - -
- 2863719..2863782 - 64 NuclAT_37 - -
- 2863719..2863782 - 64 NuclAT_37 - -
- 2863719..2863782 - 64 NuclAT_37 - -
- 2863719..2863782 - 64 NuclAT_39 - -
- 2863719..2863782 - 64 NuclAT_39 - -
- 2863719..2863782 - 64 NuclAT_39 - -
- 2863719..2863782 - 64 NuclAT_39 - -
- 2863719..2863782 - 64 NuclAT_41 - -
- 2863719..2863782 - 64 NuclAT_41 - -
- 2863719..2863782 - 64 NuclAT_41 - -
- 2863719..2863782 - 64 NuclAT_41 - -
- 2863719..2863782 - 64 NuclAT_43 - -
- 2863719..2863782 - 64 NuclAT_43 - -
- 2863719..2863782 - 64 NuclAT_43 - -
- 2863719..2863782 - 64 NuclAT_43 - -
- 2863720..2863782 - 63 NuclAT_45 - -
- 2863720..2863782 - 63 NuclAT_45 - -
- 2863720..2863782 - 63 NuclAT_45 - -
- 2863720..2863782 - 63 NuclAT_45 - -
- 2863720..2863782 - 63 NuclAT_48 - -
- 2863720..2863782 - 63 NuclAT_48 - -
- 2863720..2863782 - 63 NuclAT_48 - -
- 2863720..2863782 - 63 NuclAT_48 - -
- 2863721..2863782 - 62 NuclAT_15 - -
- 2863721..2863782 - 62 NuclAT_15 - -
- 2863721..2863782 - 62 NuclAT_15 - -
- 2863721..2863782 - 62 NuclAT_15 - -
- 2863721..2863782 - 62 NuclAT_18 - -
- 2863721..2863782 - 62 NuclAT_18 - -
- 2863721..2863782 - 62 NuclAT_18 - -
- 2863721..2863782 - 62 NuclAT_18 - -
- 2863721..2863782 - 62 NuclAT_21 - -
- 2863721..2863782 - 62 NuclAT_21 - -
- 2863721..2863782 - 62 NuclAT_21 - -
- 2863721..2863782 - 62 NuclAT_21 - -
- 2863721..2863782 - 62 NuclAT_24 - -
- 2863721..2863782 - 62 NuclAT_24 - -
- 2863721..2863782 - 62 NuclAT_24 - -
- 2863721..2863782 - 62 NuclAT_24 - -
- 2863721..2863782 - 62 NuclAT_27 - -
- 2863721..2863782 - 62 NuclAT_27 - -
- 2863721..2863782 - 62 NuclAT_27 - -
- 2863721..2863782 - 62 NuclAT_27 - -
- 2863721..2863782 - 62 NuclAT_30 - -
- 2863721..2863782 - 62 NuclAT_30 - -
- 2863721..2863782 - 62 NuclAT_30 - -
- 2863721..2863782 - 62 NuclAT_30 - -
N1709_RS14150 2863835..2863942 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2864256..2864322 - 67 NuclAT_44 - -
- 2864256..2864322 - 67 NuclAT_44 - -
- 2864256..2864322 - 67 NuclAT_44 - -
- 2864256..2864322 - 67 NuclAT_44 - -
- 2864256..2864322 - 67 NuclAT_47 - -
- 2864256..2864322 - 67 NuclAT_47 - -
- 2864256..2864322 - 67 NuclAT_47 - -
- 2864256..2864322 - 67 NuclAT_47 - -
- 2864257..2864320 - 64 NuclAT_16 - -
- 2864257..2864320 - 64 NuclAT_16 - -
- 2864257..2864320 - 64 NuclAT_16 - -
- 2864257..2864320 - 64 NuclAT_16 - -
- 2864257..2864320 - 64 NuclAT_19 - -
- 2864257..2864320 - 64 NuclAT_19 - -
- 2864257..2864320 - 64 NuclAT_19 - -
- 2864257..2864320 - 64 NuclAT_19 - -
- 2864257..2864320 - 64 NuclAT_22 - -
- 2864257..2864320 - 64 NuclAT_22 - -
- 2864257..2864320 - 64 NuclAT_22 - -
- 2864257..2864320 - 64 NuclAT_22 - -
- 2864257..2864320 - 64 NuclAT_25 - -
- 2864257..2864320 - 64 NuclAT_25 - -
- 2864257..2864320 - 64 NuclAT_25 - -
- 2864257..2864320 - 64 NuclAT_25 - -
- 2864257..2864320 - 64 NuclAT_28 - -
- 2864257..2864320 - 64 NuclAT_28 - -
- 2864257..2864320 - 64 NuclAT_28 - -
- 2864257..2864320 - 64 NuclAT_28 - -
- 2864257..2864320 - 64 NuclAT_31 - -
- 2864257..2864320 - 64 NuclAT_31 - -
- 2864257..2864320 - 64 NuclAT_31 - -
- 2864257..2864320 - 64 NuclAT_31 - -
N1709_RS14155 2864370..2864477 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
N1709_RS14160 2864626..2865480 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
N1709_RS14165 2865516..2866325 - 810 WP_001257044.1 invasion regulator SirB1 -
N1709_RS14170 2866329..2866721 - 393 WP_000200378.1 invasion regulator SirB2 -
N1709_RS14175 2866718..2867551 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T257251 WP_000170965.1 NZ_CP104117:2863299-2863406 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp


Antitoxin


Download         Length: 67 bp

>AT257251 NZ_CP104117:c2863252-2863186 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029


Antitoxin

Download structure file

References