Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2863186..2863406 | Replicon | chromosome |
| Accession | NZ_CP104117 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-50748 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | N1709_RS14145 | Protein ID | WP_000170965.1 |
| Coordinates | 2863299..2863406 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2863186..2863252 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1709_RS14120 | 2858465..2859859 | - | 1395 | WP_000086201.1 | inverse autotransporter invasin YchO | - |
| N1709_RS14125 | 2860044..2860397 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| N1709_RS14130 | 2860441..2861136 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| N1709_RS14135 | 2861294..2861524 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| N1709_RS14140 | 2861794..2862894 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2863186..2863252 | - | 67 | - | - | Antitoxin |
| N1709_RS14145 | 2863299..2863406 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2863719..2863782 | - | 64 | NuclAT_33 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_33 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_33 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_33 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_35 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_35 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_35 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_35 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_37 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_37 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_37 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_37 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_39 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_39 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_39 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_39 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_41 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_41 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_41 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_41 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_43 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_43 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_43 | - | - |
| - | 2863719..2863782 | - | 64 | NuclAT_43 | - | - |
| - | 2863720..2863782 | - | 63 | NuclAT_45 | - | - |
| - | 2863720..2863782 | - | 63 | NuclAT_45 | - | - |
| - | 2863720..2863782 | - | 63 | NuclAT_45 | - | - |
| - | 2863720..2863782 | - | 63 | NuclAT_45 | - | - |
| - | 2863720..2863782 | - | 63 | NuclAT_48 | - | - |
| - | 2863720..2863782 | - | 63 | NuclAT_48 | - | - |
| - | 2863720..2863782 | - | 63 | NuclAT_48 | - | - |
| - | 2863720..2863782 | - | 63 | NuclAT_48 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_15 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_15 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_15 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_15 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_18 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_18 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_18 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_18 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_21 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_21 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_21 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_21 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_24 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_24 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_24 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_24 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_27 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_27 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_27 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_27 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_30 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_30 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_30 | - | - |
| - | 2863721..2863782 | - | 62 | NuclAT_30 | - | - |
| N1709_RS14150 | 2863835..2863942 | + | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2864256..2864322 | - | 67 | NuclAT_44 | - | - |
| - | 2864256..2864322 | - | 67 | NuclAT_44 | - | - |
| - | 2864256..2864322 | - | 67 | NuclAT_44 | - | - |
| - | 2864256..2864322 | - | 67 | NuclAT_44 | - | - |
| - | 2864256..2864322 | - | 67 | NuclAT_47 | - | - |
| - | 2864256..2864322 | - | 67 | NuclAT_47 | - | - |
| - | 2864256..2864322 | - | 67 | NuclAT_47 | - | - |
| - | 2864256..2864322 | - | 67 | NuclAT_47 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_16 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_16 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_16 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_16 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_19 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_19 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_19 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_19 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_22 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_22 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_22 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_22 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_25 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_25 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_25 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_25 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_28 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_28 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_28 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_28 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_31 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_31 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_31 | - | - |
| - | 2864257..2864320 | - | 64 | NuclAT_31 | - | - |
| N1709_RS14155 | 2864370..2864477 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| N1709_RS14160 | 2864626..2865480 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| N1709_RS14165 | 2865516..2866325 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| N1709_RS14170 | 2866329..2866721 | - | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| N1709_RS14175 | 2866718..2867551 | - | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T257251 WP_000170965.1 NZ_CP104117:2863299-2863406 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT257251 NZ_CP104117:c2863252-2863186 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|