Detailed information of TA system TA257236

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/COG4683-HTH_37
• Location: 74603..75260
• Replicon: plasmid pEc1-51408
• Accession: NZ_CP104115
• Organism: Escherichia coli strain USDA-ARS-USMARC-51408

Toxin (Protein)

• Gene name: higB
• Uniprot ID: U3PDC3
• Locus tag: N1706_RS23075
• Protein ID: WP_000270043.1
• Coordinates: 74603..74953 (+)
• Length: 117 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: N1706_RS23080
• Protein ID: WP_000124640.1
• Coordinates: 74958..75260 (+)
• Length: 101 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N1706_RS23030 (N1706_23030)	69914..70093	+	180	Protein_71	helix-turn-helix domain-containing protein	-
N1706_RS23035 (N1706_23035)	70158..70862	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
N1706_RS23040 (N1706_23040)	71077..71574	-	498	WP_000062185.1	hypothetical protein	-
N1706_RS23045 (N1706_23045)	71577..72065	-	489	WP_001273096.1	DUF1643 domain-containing protein	-
N1706_RS23050 (N1706_23050)	72162..72497	+	336	WP_000683476.1	hypothetical protein	-
N1706_RS23055 (N1706_23055)	72512..72982	-	471	WP_001281821.1	hypothetical protein	-
N1706_RS23060 (N1706_23060)	72975..73346	-	372	WP_000516916.1	hypothetical protein	-
N1706_RS23065 (N1706_23065)	73357..73551	-	195	WP_000343597.1	hypothetical protein	-
N1706_RS23070 (N1706_23070)	73892..74440	-	549	WP_001061574.1	transcriptional regulator	-
N1706_RS23075 (N1706_23075)	74603..74953	+	351	WP_000270043.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
N1706_RS23080 (N1706_23080)	74958..75260	+	303	WP_000124640.1	XRE family transcriptional regulator	Antitoxin
N1706_RS23085 (N1706_23085)	75287..75580	-	294	WP_001239997.1	chromosome segregation protein ParM	-
N1706_RS23090 (N1706_23090)	75668..75940	-	273	WP_001043047.1	HU family DNA-binding protein	-
N1706_RS23095 (N1706_23095)	75998..76525	-	528	WP_001236377.1	thermonuclease family protein	-
N1706_RS23100 (N1706_23100)	76542..76730	-	189	WP_001270411.1	hypothetical protein	-
N1706_RS23105 (N1706_23105)	76756..77613	-	858	WP_001167032.1	hypothetical protein	-
N1706_RS23110 (N1706_23110)	77600..77830	-	231	WP_000972663.1	hypothetical protein	-
N1706_RS23115 (N1706_23115)	77830..78348	-	519	WP_000210756.1	nitrite reductase	-
N1706_RS23120 (N1706_23120)	78345..78791	-	447	WP_000919345.1	Fe3+-siderophore ABC transporter permease	-
N1706_RS23125 (N1706_23125)	78791..79150	-	360	WP_000422768.1	hypothetical protein	-
N1706_RS23130 (N1706_23130)	79207..79635	-	429	WP_000591074.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCMY-2 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / msr(E) / mph(E) / erm(42) / mph(A) / sul1 / qacE / aadA2	-	1..194998	194998

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-like (12-106)

Antitoxin

• Cro/C1-type helix-turn-helix domain (33-79)

Sequences

Toxin

Protein

• Length: 117 a.a.
• Molecular weight: 13328.21 Da
• Isoelectric Point: 5.2421

>T257236 WP_000270043.1 NZ_CP104115:74603-74953 [Escherichia coli]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Nucleotide

• Length: 351 bp

Antitoxin

Protein

• Length: 101 a.a.
• Molecular weight: 11006.73 Da
• Isoelectric Point: 7.2036

>AT257236 WP_000124640.1 NZ_CP104115:74958-75260 [Escherichia coli]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Nucleotide

• Length: 303 bp

Structures

Toxin

• AlphaFold DB: A0A7G8AFB9