Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 3950916..3951609 | Replicon | chromosome |
| Accession | NZ_CP104114 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-51408 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | N1706_RS19005 | Protein ID | WP_000415584.1 |
| Coordinates | 3951313..3951609 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | N1706_RS19000 | Protein ID | WP_000650107.1 |
| Coordinates | 3950916..3951311 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1706_RS18990 (3946780) | 3946780..3949038 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
| N1706_RS18995 (3949176) | 3949176..3950783 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| N1706_RS19000 (3950916) | 3950916..3951311 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| N1706_RS19005 (3951313) | 3951313..3951609 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| N1706_RS19010 (3951814) | 3951814..3952296 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| N1706_RS19015 (3952349) | 3952349..3952741 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| N1706_RS19020 (3952893) | 3952893..3953552 | + | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| N1706_RS19025 (3953549) | 3953549..3954898 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| N1706_RS19030 (3954944) | 3954944..3955276 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
| N1706_RS19035 (3955595) | 3955595..3956176 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| N1706_RS19040 (3956207) | 3956207..3956521 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T257233 WP_000415584.1 NZ_CP104114:c3951609-3951313 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT257233 WP_000650107.1 NZ_CP104114:c3951311-3950916 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|