Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2233477..2234115 | Replicon | chromosome |
Accession | NZ_CP104114 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-51408 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N1706_RS10760 | Protein ID | WP_000813794.1 |
Coordinates | 2233477..2233653 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N1706_RS10765 | Protein ID | WP_001270286.1 |
Coordinates | 2233699..2234115 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1706_RS10740 (2229096) | 2229096..2230310 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
N1706_RS10745 (2230363) | 2230363..2230899 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
N1706_RS10750 (2230972) | 2230972..2232933 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N1706_RS10755 (2233025) | 2233025..2233255 | - | 231 | WP_000494244.1 | YncJ family protein | - |
N1706_RS10760 (2233477) | 2233477..2233653 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N1706_RS10765 (2233699) | 2233699..2234115 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N1706_RS10770 (2234194) | 2234194..2235600 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
N1706_RS10775 (2235845) | 2235845..2236990 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
N1706_RS10780 (2237008) | 2237008..2238021 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
N1706_RS10785 (2238022) | 2238022..2238963 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2227908..2229056 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T257223 WP_000813794.1 NZ_CP104114:2233477-2233653 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT257223 WP_001270286.1 NZ_CP104114:2233699-2234115 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|