Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2024203..2024423 Replicon chromosome
Accession NZ_CP104114
Organism Escherichia coli strain USDA-ARS-USMARC-51408

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag N1706_RS09730 Protein ID WP_000170954.1
Coordinates 2024203..2024310 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2024360..2024423 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N1706_RS09705 (2020047) 2020047..2021129 + 1083 WP_000804726.1 peptide chain release factor 1 -
N1706_RS09710 (2021129) 2021129..2021962 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
N1706_RS09715 (2021959) 2021959..2022351 + 393 WP_000200392.1 invasion regulator SirB2 -
N1706_RS09720 (2022355) 2022355..2023164 + 810 WP_001257044.1 invasion regulator SirB1 -
N1706_RS09725 (2023200) 2023200..2024054 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
N1706_RS09730 (2024203) 2024203..2024310 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2024360) 2024360..2024423 + 64 NuclAT_35 - Antitoxin
- (2024360) 2024360..2024423 + 64 NuclAT_35 - Antitoxin
- (2024360) 2024360..2024423 + 64 NuclAT_35 - Antitoxin
- (2024360) 2024360..2024423 + 64 NuclAT_35 - Antitoxin
N1706_RS09735 (2024738) 2024738..2024845 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2024898) 2024898..2024959 + 62 NuclAT_34 - -
- (2024898) 2024898..2024959 + 62 NuclAT_34 - -
- (2024898) 2024898..2024959 + 62 NuclAT_34 - -
- (2024898) 2024898..2024959 + 62 NuclAT_34 - -
- (2024898) 2024898..2024961 + 64 NuclAT_14 - -
- (2024898) 2024898..2024961 + 64 NuclAT_14 - -
- (2024898) 2024898..2024961 + 64 NuclAT_14 - -
- (2024898) 2024898..2024961 + 64 NuclAT_14 - -
- (2024898) 2024898..2024961 + 64 NuclAT_16 - -
- (2024898) 2024898..2024961 + 64 NuclAT_16 - -
- (2024898) 2024898..2024961 + 64 NuclAT_16 - -
- (2024898) 2024898..2024961 + 64 NuclAT_16 - -
- (2024898) 2024898..2024961 + 64 NuclAT_18 - -
- (2024898) 2024898..2024961 + 64 NuclAT_18 - -
- (2024898) 2024898..2024961 + 64 NuclAT_18 - -
- (2024898) 2024898..2024961 + 64 NuclAT_18 - -
- (2024898) 2024898..2024961 + 64 NuclAT_20 - -
- (2024898) 2024898..2024961 + 64 NuclAT_20 - -
- (2024898) 2024898..2024961 + 64 NuclAT_20 - -
- (2024898) 2024898..2024961 + 64 NuclAT_20 - -
- (2024898) 2024898..2024961 + 64 NuclAT_22 - -
- (2024898) 2024898..2024961 + 64 NuclAT_22 - -
- (2024898) 2024898..2024961 + 64 NuclAT_22 - -
- (2024898) 2024898..2024961 + 64 NuclAT_22 - -
- (2024898) 2024898..2024961 + 64 NuclAT_24 - -
- (2024898) 2024898..2024961 + 64 NuclAT_24 - -
- (2024898) 2024898..2024961 + 64 NuclAT_24 - -
- (2024898) 2024898..2024961 + 64 NuclAT_24 - -
N1706_RS09740 (2025274) 2025274..2025381 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2025429) 2025429..2025494 + 66 NuclAT_33 - -
- (2025429) 2025429..2025494 + 66 NuclAT_33 - -
- (2025429) 2025429..2025494 + 66 NuclAT_33 - -
- (2025429) 2025429..2025494 + 66 NuclAT_33 - -
- (2025429) 2025429..2025496 + 68 NuclAT_13 - -
- (2025429) 2025429..2025496 + 68 NuclAT_13 - -
- (2025429) 2025429..2025496 + 68 NuclAT_13 - -
- (2025429) 2025429..2025496 + 68 NuclAT_13 - -
- (2025429) 2025429..2025496 + 68 NuclAT_15 - -
- (2025429) 2025429..2025496 + 68 NuclAT_15 - -
- (2025429) 2025429..2025496 + 68 NuclAT_15 - -
- (2025429) 2025429..2025496 + 68 NuclAT_15 - -
- (2025429) 2025429..2025496 + 68 NuclAT_17 - -
- (2025429) 2025429..2025496 + 68 NuclAT_17 - -
- (2025429) 2025429..2025496 + 68 NuclAT_17 - -
- (2025429) 2025429..2025496 + 68 NuclAT_17 - -
- (2025429) 2025429..2025496 + 68 NuclAT_19 - -
- (2025429) 2025429..2025496 + 68 NuclAT_19 - -
- (2025429) 2025429..2025496 + 68 NuclAT_19 - -
- (2025429) 2025429..2025496 + 68 NuclAT_19 - -
- (2025429) 2025429..2025496 + 68 NuclAT_21 - -
- (2025429) 2025429..2025496 + 68 NuclAT_21 - -
- (2025429) 2025429..2025496 + 68 NuclAT_21 - -
- (2025429) 2025429..2025496 + 68 NuclAT_21 - -
- (2025429) 2025429..2025496 + 68 NuclAT_23 - -
- (2025429) 2025429..2025496 + 68 NuclAT_23 - -
- (2025429) 2025429..2025496 + 68 NuclAT_23 - -
- (2025429) 2025429..2025496 + 68 NuclAT_23 - -
N1706_RS09745 (2025786) 2025786..2026886 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
N1706_RS09750 (2027156) 2027156..2027386 + 231 WP_001146442.1 putative cation transport regulator ChaB -
N1706_RS09755 (2027544) 2027544..2028239 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
N1706_RS09760 (2028283) 2028283..2028636 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T257222 WP_000170954.1 NZ_CP104114:c2024310-2024203 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 64 bp

>AT257222 NZ_CP104114:2024360-2024423 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References