Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2024203..2024423 | Replicon | chromosome |
| Accession | NZ_CP104114 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-51408 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | N1706_RS09730 | Protein ID | WP_000170954.1 |
| Coordinates | 2024203..2024310 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2024360..2024423 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1706_RS09705 (2020047) | 2020047..2021129 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| N1706_RS09710 (2021129) | 2021129..2021962 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| N1706_RS09715 (2021959) | 2021959..2022351 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| N1706_RS09720 (2022355) | 2022355..2023164 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| N1706_RS09725 (2023200) | 2023200..2024054 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| N1706_RS09730 (2024203) | 2024203..2024310 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (2024360) | 2024360..2024423 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (2024360) | 2024360..2024423 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (2024360) | 2024360..2024423 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (2024360) | 2024360..2024423 | + | 64 | NuclAT_35 | - | Antitoxin |
| N1706_RS09735 (2024738) | 2024738..2024845 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2024898) | 2024898..2024959 | + | 62 | NuclAT_34 | - | - |
| - (2024898) | 2024898..2024959 | + | 62 | NuclAT_34 | - | - |
| - (2024898) | 2024898..2024959 | + | 62 | NuclAT_34 | - | - |
| - (2024898) | 2024898..2024959 | + | 62 | NuclAT_34 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_14 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_14 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_14 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_14 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_16 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_16 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_16 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_16 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_18 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_18 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_18 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_18 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_20 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_20 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_20 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_20 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_22 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_22 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_22 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_22 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_24 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_24 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_24 | - | - |
| - (2024898) | 2024898..2024961 | + | 64 | NuclAT_24 | - | - |
| N1706_RS09740 (2025274) | 2025274..2025381 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2025429) | 2025429..2025494 | + | 66 | NuclAT_33 | - | - |
| - (2025429) | 2025429..2025494 | + | 66 | NuclAT_33 | - | - |
| - (2025429) | 2025429..2025494 | + | 66 | NuclAT_33 | - | - |
| - (2025429) | 2025429..2025494 | + | 66 | NuclAT_33 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_13 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_13 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_13 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_13 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_15 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_15 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_15 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_15 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_17 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_17 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_17 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_17 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_19 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_19 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_19 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_19 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_21 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_21 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_21 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_21 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_23 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_23 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_23 | - | - |
| - (2025429) | 2025429..2025496 | + | 68 | NuclAT_23 | - | - |
| N1706_RS09745 (2025786) | 2025786..2026886 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| N1706_RS09750 (2027156) | 2027156..2027386 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| N1706_RS09755 (2027544) | 2027544..2028239 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| N1706_RS09760 (2028283) | 2028283..2028636 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T257222 WP_000170954.1 NZ_CP104114:c2024310-2024203 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 64 bp
>AT257222 NZ_CP104114:2024360-2024423 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|