Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 647085..647497 | Replicon | chromosome |
Accession | NZ_CP104114 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-51408 |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A0B1K116 |
Locus tag | N1706_RS03035 | Protein ID | WP_000132623.1 |
Coordinates | 647085..647426 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 647421..647497 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1706_RS03015 (643094) | 643094..644506 | - | 1413 | WP_032304527.1 | PLP-dependent aminotransferase family protein | - |
N1706_RS03020 (644683) | 644683..644847 | + | 165 | WP_000394278.1 | DUF1127 domain-containing protein | - |
N1706_RS03025 (644945) | 644945..645827 | + | 883 | Protein_572 | DUF262 domain-containing protein | - |
N1706_RS03030 (645875) | 645875..647038 | + | 1164 | WP_071940936.1 | DUF1524 domain-containing protein | - |
N1706_RS03035 (647085) | 647085..647426 | - | 342 | WP_000132623.1 | endoribonuclease SymE | Toxin |
- (647421) | 647421..647497 | + | 77 | NuclAT_27 | - | Antitoxin |
- (647421) | 647421..647497 | + | 77 | NuclAT_27 | - | Antitoxin |
- (647421) | 647421..647497 | + | 77 | NuclAT_27 | - | Antitoxin |
- (647421) | 647421..647497 | + | 77 | NuclAT_27 | - | Antitoxin |
- (647421) | 647421..647497 | + | 77 | NuclAT_28 | - | Antitoxin |
- (647421) | 647421..647497 | + | 77 | NuclAT_28 | - | Antitoxin |
- (647421) | 647421..647497 | + | 77 | NuclAT_28 | - | Antitoxin |
- (647421) | 647421..647497 | + | 77 | NuclAT_28 | - | Antitoxin |
N1706_RS03040 (647641) | 647641..650904 | - | 3264 | WP_000058876.1 | HsdR family type I site-specific deoxyribonuclease | - |
N1706_RS03045 (650999) | 650999..652396 | - | 1398 | WP_260223208.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12323.21 Da Isoelectric Point: 9.5818
>T257218 WP_000132623.1 NZ_CP104114:c647426-647085 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMKGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVREFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMKGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVREFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT257218 NZ_CP104114:647421-647497 [Escherichia coli]
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|