Detailed information of TA system TA257216

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/COG4683-HTH_37
• Location: 145668..146325
• Replicon: plasmid pEc1-51688
• Accession: NZ_CP104113
• Organism: Escherichia coli strain USDA-ARS-USMARC-51688

Toxin (Protein)

• Gene name: higB
• Uniprot ID: U3PDC3
• Locus tag: N1707_RS22960
• Protein ID: WP_000270043.1
• Coordinates: 145668..146018 (+)
• Length: 117 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: N1707_RS22965
• Protein ID: WP_000124640.1
• Coordinates: 146023..146325 (+)
• Length: 101 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N1707_RS22915 (N1707_22915)	140979..141158	+	180	Protein_145	helix-turn-helix domain-containing protein	-
N1707_RS22920 (N1707_22920)	141223..141927	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
N1707_RS22925 (N1707_22925)	142142..142639	-	498	WP_000062185.1	hypothetical protein	-
N1707_RS22930 (N1707_22930)	142642..143130	-	489	WP_001273096.1	DUF1643 domain-containing protein	-
N1707_RS22935 (N1707_22935)	143227..143562	+	336	WP_000683476.1	hypothetical protein	-
N1707_RS22940 (N1707_22940)	143577..144047	-	471	WP_001281821.1	hypothetical protein	-
N1707_RS22945 (N1707_22945)	144040..144411	-	372	WP_000516916.1	hypothetical protein	-
N1707_RS22950 (N1707_22950)	144422..144616	-	195	WP_000343597.1	hypothetical protein	-
N1707_RS22955 (N1707_22955)	144957..145505	-	549	WP_001061574.1	transcriptional regulator	-
N1707_RS22960 (N1707_22960)	145668..146018	+	351	WP_000270043.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
N1707_RS22965 (N1707_22965)	146023..146325	+	303	WP_000124640.1	XRE family transcriptional regulator	Antitoxin
N1707_RS22970 (N1707_22970)	146352..146645	-	294	WP_001239997.1	chromosome segregation protein ParM	-
N1707_RS22975 (N1707_22975)	146733..147005	-	273	WP_001043047.1	HU family DNA-binding protein	-
N1707_RS22980 (N1707_22980)	147063..147590	-	528	WP_001236377.1	thermonuclease family protein	-
N1707_RS22985 (N1707_22985)	147821..148678	-	858	WP_001167032.1	hypothetical protein	-
N1707_RS22990 (N1707_22990)	148665..148895	-	231	WP_000972663.1	hypothetical protein	-
N1707_RS22995 (N1707_22995)	148895..149413	-	519	WP_000210756.1	nitrite reductase	-
N1707_RS23000 (N1707_23000)	149410..149856	-	447	WP_000919345.1	Fe3+-siderophore ABC transporter permease	-
N1707_RS23005 (N1707_23005)	149856..150215	-	360	WP_000422768.1	hypothetical protein	-
N1707_RS23010 (N1707_23010)	150272..150700	-	429	WP_000591074.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aph(3'')-Ib / aph(6)-Id / msr(E) / mph(E) / sul2 / erm(42) / mph(A) / sul1 / qacE / aadA2 / blaCMY-2 / tet(A) / floR	-	1..194997	194997

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-like (12-106)

Antitoxin

• Cro/C1-type helix-turn-helix domain (33-79)

Sequences

Toxin

Protein

• Length: 117 a.a.
• Molecular weight: 13328.21 Da
• Isoelectric Point: 5.2421

>T257216 WP_000270043.1 NZ_CP104113:145668-146018 [Escherichia coli]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Nucleotide

• Length: 351 bp

Antitoxin

Protein

• Length: 101 a.a.
• Molecular weight: 11006.73 Da
• Isoelectric Point: 7.2036

>AT257216 WP_000124640.1 NZ_CP104113:146023-146325 [Escherichia coli]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Nucleotide

• Length: 303 bp

Structures

Toxin

• AlphaFold DB: A0A7G8AFB9