Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 145668..146325 | Replicon | plasmid pEc1-51688 |
| Accession | NZ_CP104113 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-51688 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | N1707_RS22960 | Protein ID | WP_000270043.1 |
| Coordinates | 145668..146018 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N1707_RS22965 | Protein ID | WP_000124640.1 |
| Coordinates | 146023..146325 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1707_RS22915 (N1707_22915) | 140979..141158 | + | 180 | Protein_145 | helix-turn-helix domain-containing protein | - |
| N1707_RS22920 (N1707_22920) | 141223..141927 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| N1707_RS22925 (N1707_22925) | 142142..142639 | - | 498 | WP_000062185.1 | hypothetical protein | - |
| N1707_RS22930 (N1707_22930) | 142642..143130 | - | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| N1707_RS22935 (N1707_22935) | 143227..143562 | + | 336 | WP_000683476.1 | hypothetical protein | - |
| N1707_RS22940 (N1707_22940) | 143577..144047 | - | 471 | WP_001281821.1 | hypothetical protein | - |
| N1707_RS22945 (N1707_22945) | 144040..144411 | - | 372 | WP_000516916.1 | hypothetical protein | - |
| N1707_RS22950 (N1707_22950) | 144422..144616 | - | 195 | WP_000343597.1 | hypothetical protein | - |
| N1707_RS22955 (N1707_22955) | 144957..145505 | - | 549 | WP_001061574.1 | transcriptional regulator | - |
| N1707_RS22960 (N1707_22960) | 145668..146018 | + | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N1707_RS22965 (N1707_22965) | 146023..146325 | + | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| N1707_RS22970 (N1707_22970) | 146352..146645 | - | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
| N1707_RS22975 (N1707_22975) | 146733..147005 | - | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
| N1707_RS22980 (N1707_22980) | 147063..147590 | - | 528 | WP_001236377.1 | thermonuclease family protein | - |
| N1707_RS22985 (N1707_22985) | 147821..148678 | - | 858 | WP_001167032.1 | hypothetical protein | - |
| N1707_RS22990 (N1707_22990) | 148665..148895 | - | 231 | WP_000972663.1 | hypothetical protein | - |
| N1707_RS22995 (N1707_22995) | 148895..149413 | - | 519 | WP_000210756.1 | nitrite reductase | - |
| N1707_RS23000 (N1707_23000) | 149410..149856 | - | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
| N1707_RS23005 (N1707_23005) | 149856..150215 | - | 360 | WP_000422768.1 | hypothetical protein | - |
| N1707_RS23010 (N1707_23010) | 150272..150700 | - | 429 | WP_000591074.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3'')-Ib / aph(6)-Id / msr(E) / mph(E) / sul2 / erm(42) / mph(A) / sul1 / qacE / aadA2 / blaCMY-2 / tet(A) / floR | - | 1..194997 | 194997 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T257216 WP_000270043.1 NZ_CP104113:145668-146018 [Escherichia coli]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|