Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3784009..3784702 | Replicon | chromosome |
Accession | NZ_CP104112 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-51688 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | N1707_RS18500 | Protein ID | WP_000415584.1 |
Coordinates | 3784406..3784702 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | N1707_RS18495 | Protein ID | WP_000650107.1 |
Coordinates | 3784009..3784404 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1707_RS18485 (3779874) | 3779874..3782132 | - | 2259 | WP_112032699.1 | DNA topoisomerase IV subunit A | - |
N1707_RS18490 (3782270) | 3782270..3783877 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
N1707_RS18495 (3784009) | 3784009..3784404 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
N1707_RS18500 (3784406) | 3784406..3784702 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
N1707_RS18505 (3784907) | 3784907..3785389 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
N1707_RS18510 (3785442) | 3785442..3785834 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
N1707_RS18515 (3785986) | 3785986..3786645 | + | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
N1707_RS18520 (3786642) | 3786642..3787991 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
N1707_RS18525 (3788037) | 3788037..3788369 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
N1707_RS18530 (3788688) | 3788688..3789269 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
N1707_RS18535 (3789300) | 3789300..3789614 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T257213 WP_000415584.1 NZ_CP104112:c3784702-3784406 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT257213 WP_000650107.1 NZ_CP104112:c3784404-3784009 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|