Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1941402..1941623 | Replicon | chromosome |
| Accession | NZ_CP104112 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-51688 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | N1707_RS09460 | Protein ID | WP_000170963.1 |
| Coordinates | 1941402..1941509 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1941557..1941623 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1707_RS09430 (1936713) | 1936713..1937795 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| N1707_RS09435 (1937795) | 1937795..1938628 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| N1707_RS09440 (1938625) | 1938625..1939017 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| N1707_RS09445 (1939021) | 1939021..1939830 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| N1707_RS09450 (1939866) | 1939866..1940720 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| N1707_RS09455 (1940867) | 1940867..1940974 | - | 108 | WP_000170951.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_30 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_30 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_30 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_30 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_32 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_32 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_32 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_32 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_34 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_34 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_34 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_34 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_36 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_36 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_36 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_36 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_38 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_38 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_38 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_38 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_40 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_40 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_40 | - | - |
| - (1941022) | 1941022..1941088 | + | 67 | NuclAT_40 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_14 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_14 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_14 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_14 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_17 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_17 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_17 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_17 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_20 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_20 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_20 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_20 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_23 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_23 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_23 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_23 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_26 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_26 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_26 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_26 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_29 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_29 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_29 | - | - |
| - (1941024) | 1941024..1941089 | + | 66 | NuclAT_29 | - | - |
| N1707_RS09460 (1941402) | 1941402..1941509 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_31 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_31 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_31 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_31 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_33 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_33 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_33 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_33 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_35 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_35 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_35 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_35 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_37 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_37 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_37 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_37 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_39 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_39 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_39 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_39 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_41 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_41 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_41 | - | - |
| - (1941558) | 1941558..1941622 | + | 65 | NuclAT_41 | - | - |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_16 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_16 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_16 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_16 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_22 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_22 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_22 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_22 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_28 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_28 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_28 | - | Antitoxin |
| - (1941557) | 1941557..1941623 | + | 67 | NuclAT_28 | - | Antitoxin |
| N1707_RS09465 (1941936) | 1941936..1942043 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_12 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_12 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_12 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_12 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_15 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_15 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_15 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_15 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_18 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_18 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_18 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_18 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_21 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_21 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_21 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_21 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_24 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_24 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_24 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_24 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_27 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_27 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_27 | - | - |
| - (1942091) | 1942091..1942158 | + | 68 | NuclAT_27 | - | - |
| N1707_RS09470 (1942448) | 1942448..1943548 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| N1707_RS09475 (1943818) | 1943818..1944048 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| N1707_RS09480 (1944206) | 1944206..1944901 | + | 696 | WP_255233229.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| N1707_RS09485 (1944945) | 1944945..1945298 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T257198 WP_000170963.1 NZ_CP104112:c1941509-1941402 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT257198 NZ_CP104112:1941557-1941623 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
