Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 920234..920928 | Replicon | chromosome |
Accession | NZ_CP104112 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-51688 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1EXB8 |
Locus tag | N1707_RS04400 | Protein ID | WP_001263493.1 |
Coordinates | 920530..920928 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | N1707_RS04395 | Protein ID | WP_000554757.1 |
Coordinates | 920234..920527 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1707_RS04380 (917267) | 917267..918130 | + | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
N1707_RS04385 (918133) | 918133..919056 | + | 924 | WP_112032734.1 | putative lateral flagellar export/assembly protein LafU | - |
N1707_RS04390 (919127) | 919127..920182 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
N1707_RS04395 (920234) | 920234..920527 | + | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
N1707_RS04400 (920530) | 920530..920928 | + | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
N1707_RS04405 (920938) | 920938..921390 | + | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
N1707_RS04410 (921636) | 921636..921839 | + | 204 | Protein_839 | RtcB family protein | - |
N1707_RS04415 (921838) | 921838..922359 | + | 522 | Protein_840 | peptide chain release factor H | - |
N1707_RS04420 (922416) | 922416..923873 | - | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
N1707_RS04425 (924134) | 924134..924592 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (925188) | 925188..925268 | + | 81 | NuclAT_10 | - | - |
- (925188) | 925188..925268 | + | 81 | NuclAT_10 | - | - |
- (925188) | 925188..925268 | + | 81 | NuclAT_10 | - | - |
- (925188) | 925188..925268 | + | 81 | NuclAT_10 | - | - |
N1707_RS04430 (924684) | 924684..925928 | + | 1245 | WP_000189541.1 | esterase FrsA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 916478..916981 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T257195 WP_001263493.1 NZ_CP104112:920530-920928 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|