Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4092364..4092965 | Replicon | chromosome |
Accession | NZ_CP104108 | ||
Organism | Cronobacter sakazakii strain USDA-ARS-USMARC-54664 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A855WMY7 |
Locus tag | N1710_RS19200 | Protein ID | WP_054623952.1 |
Coordinates | 4092654..4092965 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N1710_RS19195 | Protein ID | WP_007871962.1 |
Coordinates | 4092364..4092654 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1710_RS19180 (N1710_19180) | 4089830..4090732 | + | 903 | WP_004385164.1 | formate dehydrogenase subunit beta | - |
N1710_RS19185 (N1710_19185) | 4090729..4091364 | + | 636 | WP_004385165.1 | formate dehydrogenase cytochrome b556 subunit | - |
N1710_RS19190 (N1710_19190) | 4091361..4092290 | + | 930 | WP_007871963.1 | formate dehydrogenase accessory protein FdhE | - |
N1710_RS19195 (N1710_19195) | 4092364..4092654 | - | 291 | WP_007871962.1 | NadS family protein | Antitoxin |
N1710_RS19200 (N1710_19200) | 4092654..4092965 | - | 312 | WP_054623952.1 | hypothetical protein | Toxin |
N1710_RS19205 (N1710_19205) | 4093140..4093964 | - | 825 | WP_007899185.1 | AraC family transcriptional regulator | - |
N1710_RS19210 (N1710_19210) | 4094225..4095628 | + | 1404 | WP_105568618.1 | MFS transporter | - |
N1710_RS19215 (N1710_19215) | 4095640..4097607 | + | 1968 | WP_105568617.1 | glycoside hydrolase family 127 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12155.11 Da Isoelectric Point: 9.7588
>T257178 WP_054623952.1 NZ_CP104108:c4092965-4092654 [Cronobacter sakazakii]
MLFIETEIFTRAVTALLSDDDYQRLQWFLALRPDYGDVIPDTGGLRKVRWLSGGRGKRGGVRIIYFYRPVDDEIRLLLIY
RKGIKDDLSPHEKAVLRMLNERW
MLFIETEIFTRAVTALLSDDDYQRLQWFLALRPDYGDVIPDTGGLRKVRWLSGGRGKRGGVRIIYFYRPVDDEIRLLLIY
RKGIKDDLSPHEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|