Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1414838..1415485 | Replicon | chromosome |
| Accession | NZ_CP104108 | ||
| Organism | Cronobacter sakazakii strain USDA-ARS-USMARC-54664 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N1710_RS06630 | Protein ID | WP_105546258.1 |
| Coordinates | 1414838..1415185 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | V5TYW5 |
| Locus tag | N1710_RS06635 | Protein ID | WP_007776551.1 |
| Coordinates | 1415186..1415485 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1710_RS06605 (N1710_06605) | 1410109..1411119 | + | 1011 | WP_004387466.1 | galactose/methyl galactoside ABC transporter permease MglC | - |
| N1710_RS06610 (N1710_06610) | 1411640..1412353 | - | 714 | WP_004387784.1 | outer membrane permeability protein SanA | - |
| N1710_RS06615 (N1710_06615) | 1412478..1413362 | - | 885 | WP_105546257.1 | cytidine deaminase | - |
| N1710_RS06620 (N1710_06620) | 1413492..1414187 | - | 696 | WP_007869369.1 | CidB/LrgB family autolysis modulator | - |
| N1710_RS06625 (N1710_06625) | 1414184..1414585 | - | 402 | WP_097641629.1 | CidA/LrgA family protein | - |
| N1710_RS06630 (N1710_06630) | 1414838..1415185 | + | 348 | WP_105546258.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N1710_RS06635 (N1710_06635) | 1415186..1415485 | + | 300 | WP_007776551.1 | XRE family transcriptional regulator | Antitoxin |
| N1710_RS06640 (N1710_06640) | 1415558..1416490 | + | 933 | WP_012124281.1 | tRNA dihydrouridine(16) synthase DusC | - |
| N1710_RS06645 (N1710_06645) | 1416493..1417416 | - | 924 | WP_104671343.1 | LysR family transcriptional regulator | - |
| N1710_RS06650 (N1710_06650) | 1417489..1418448 | + | 960 | WP_105546259.1 | MBL fold metallo-hydrolase | - |
| N1710_RS06655 (N1710_06655) | 1418485..1418568 | - | 84 | WP_000691708.1 | small membrane protein YohP | - |
| N1710_RS06660 (N1710_06660) | 1418741..1419514 | + | 774 | WP_105546260.1 | SDR family oxidoreductase | - |
| N1710_RS06665 (N1710_06665) | 1419511..1420077 | - | 567 | WP_105546261.1 | DedA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13471.79 Da Isoelectric Point: 10.3525
>T257171 WP_105546258.1 NZ_CP104108:1414838-1415185 [Cronobacter sakazakii]
MWTIYLTHEFECWLARQPQPLQEDVLAALGLLKIKGPHLGRPYADTLKGSRHTGMKALRVQHAVRPIRAFYAFDPHRYAI
VLCAAQKKGDEKRFYRVMLRVADKLFSHYLNHREV
MWTIYLTHEFECWLARQPQPLQEDVLAALGLLKIKGPHLGRPYADTLKGSRHTGMKALRVQHAVRPIRAFYAFDPHRYAI
VLCAAQKKGDEKRFYRVMLRVADKLFSHYLNHREV
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|