Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-as-bsrH/- |
| Location | 2240739..2240956 | Replicon | chromosome |
| Accession | NZ_CP104097 | ||
| Organism | Bacillus subtilis strain GL-4 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | - |
| Locus tag | N1207_RS11560 | Protein ID | WP_109962752.1 |
| Coordinates | 2240739..2240915 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrH | ||
| Locus tag | - | ||
| Coordinates | 2240856..2240956 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1207_RS11515 (2235850) | 2235850..2236185 | - | 336 | WP_109962744.1 | hypothetical protein | - |
| N1207_RS11520 (2236223) | 2236223..2236519 | - | 297 | WP_109962745.1 | hypothetical protein | - |
| N1207_RS11525 (2236595) | 2236595..2236840 | - | 246 | WP_109962746.1 | hypothetical protein | - |
| N1207_RS11530 (2236840) | 2236840..2237040 | - | 201 | WP_109962747.1 | hypothetical protein | - |
| N1207_RS11535 (2237078) | 2237078..2237977 | - | 900 | WP_109962748.1 | hypothetical protein | - |
| N1207_RS11540 (2238089) | 2238089..2238520 | - | 432 | WP_109962749.1 | hypothetical protein | - |
| N1207_RS11545 (2238937) | 2238937..2240154 | - | 1218 | WP_109962750.1 | hypothetical protein | - |
| N1207_RS11550 (2240236) | 2240236..2240424 | - | 189 | WP_003230987.1 | hypothetical protein | - |
| N1207_RS11555 (2240469) | 2240469..2240720 | - | 252 | WP_109962751.1 | hypothetical protein | - |
| N1207_RS11560 (2240739) | 2240739..2240915 | - | 177 | WP_109962752.1 | hypothetical protein | Toxin |
| - (2240856) | 2240856..2240956 | + | 101 | NuclAT_1 | - | Antitoxin |
| - (2240856) | 2240856..2240956 | + | 101 | NuclAT_1 | - | Antitoxin |
| - (2240856) | 2240856..2240956 | + | 101 | NuclAT_1 | - | Antitoxin |
| - (2240856) | 2240856..2240956 | + | 101 | NuclAT_1 | - | Antitoxin |
| N1207_RS11565 (2241947) | 2241947..2242141 | + | 195 | WP_004399291.1 | hypothetical protein | - |
| N1207_RS11570 (2242181) | 2242181..2244688 | + | 2508 | WP_109962753.1 | DNA-directed RNA polymerase YonO | - |
| N1207_RS11575 (2244952) | 2244952..2245227 | + | 276 | WP_072692660.1 | HU family DNA-binding protein | - |
| N1207_RS11580 (2245650) | 2245650..2245761 | + | 112 | Protein_2228 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2173860..2304017 | 130157 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6859.40 Da Isoelectric Point: 12.8196
>T257157 WP_109962752.1 NZ_CP104097:c2240915-2240739 [Bacillus subtilis]
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQHIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQHIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT257157 NZ_CP104097:2240856-2240956 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATAATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATAATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|