Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2240698..2240915 | Replicon | chromosome |
Accession | NZ_CP104097 | ||
Organism | Bacillus subtilis strain GL-4 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | - |
Locus tag | N1207_RS11560 | Protein ID | WP_109962752.1 |
Coordinates | 2240739..2240915 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2240698..2240798 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1207_RS11515 | 2235850..2236185 | - | 336 | WP_109962744.1 | hypothetical protein | - |
N1207_RS11520 | 2236223..2236519 | - | 297 | WP_109962745.1 | hypothetical protein | - |
N1207_RS11525 | 2236595..2236840 | - | 246 | WP_109962746.1 | hypothetical protein | - |
N1207_RS11530 | 2236840..2237040 | - | 201 | WP_109962747.1 | hypothetical protein | - |
N1207_RS11535 | 2237078..2237977 | - | 900 | WP_109962748.1 | hypothetical protein | - |
N1207_RS11540 | 2238089..2238520 | - | 432 | WP_109962749.1 | hypothetical protein | - |
N1207_RS11545 | 2238937..2240154 | - | 1218 | WP_109962750.1 | hypothetical protein | - |
N1207_RS11550 | 2240236..2240424 | - | 189 | WP_003230987.1 | hypothetical protein | - |
N1207_RS11555 | 2240469..2240720 | - | 252 | WP_109962751.1 | hypothetical protein | - |
- | 2240698..2240798 | + | 101 | - | - | Antitoxin |
N1207_RS11560 | 2240739..2240915 | - | 177 | WP_109962752.1 | hypothetical protein | Toxin |
- | 2240856..2240956 | + | 101 | NuclAT_1 | - | - |
- | 2240856..2240956 | + | 101 | NuclAT_1 | - | - |
- | 2240856..2240956 | + | 101 | NuclAT_1 | - | - |
- | 2240856..2240956 | + | 101 | NuclAT_1 | - | - |
N1207_RS11565 | 2241947..2242141 | + | 195 | WP_004399291.1 | hypothetical protein | - |
N1207_RS11570 | 2242181..2244688 | + | 2508 | WP_109962753.1 | DNA-directed RNA polymerase YonO | - |
N1207_RS11575 | 2244952..2245227 | + | 276 | WP_072692660.1 | HU family DNA-binding protein | - |
N1207_RS11580 | 2245650..2245761 | + | 112 | Protein_2228 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2173860..2304017 | 130157 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6859.40 Da Isoelectric Point: 12.8196
>T257155 WP_109962752.1 NZ_CP104097:c2240915-2240739 [Bacillus subtilis]
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQHIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQHIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT257155 NZ_CP104097:2240698-2240798 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATATGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATATGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|