Detailed information of TA system TA257142

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 60292..60561
• Replicon: plasmid pHB42-2
• Accession: NZ_CP104079
• Organism: Escherichia coli strain HB42

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N0M81_RS23685
• Protein ID: WP_001372321.1
• Coordinates: 60436..60561 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	60292..60357 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N0M81_RS23645	55294..55755	-	462	Protein_61	hypothetical protein	-
N0M81_RS23650	56057..56584	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
N0M81_RS23655	56642..56875	+	234	WP_000006003.1	DUF905 family protein	-
N0M81_RS23660	56936..58904	+	1969	Protein_64	ParB/RepB/Spo0J family partition protein	-
N0M81_RS23665	58973..59407	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
N0M81_RS23670	59404..60166	+	763	Protein_66	plasmid SOS inhibition protein A	-
-	60135..60359	+	225	NuclAT_0	-	-
-	60135..60359	+	225	NuclAT_0	-	-
-	60135..60359	+	225	NuclAT_0	-	-
-	60135..60359	+	225	NuclAT_0	-	-
N0M81_RS23675	60144..60323	-	180	WP_001309233.1	hypothetical protein	-
-	60292..60357	-	66	-	-	Antitoxin
N0M81_RS23680	60345..60494	+	150	Protein_68	plasmid maintenance protein Mok	-
N0M81_RS23685	60436..60561	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N0M81_RS23690	60880..61176	-	297	Protein_70	hypothetical protein	-
N0M81_RS23695	61476..61772	+	297	WP_001272251.1	hypothetical protein	-
N0M81_RS23700	61883..62704	+	822	WP_001234445.1	DUF932 domain-containing protein	-
N0M81_RS23705	63001..63648	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
N0M81_RS23710	63925..64308	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N0M81_RS23715	64499..65185	+	687	WP_015059009.1	PAS domain-containing protein	-
N0M81_RS23720	65279..65506	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	dfrA12 / aadA2 / qacE / mph(A) / blaTEM-1B / rmtB / blaCTX-M-55	-	1..100197	100197

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T257142 WP_001372321.1 NZ_CP104079:60436-60561 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT257142 NZ_CP104079:c60357-60292 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin