Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 115781..116050 Replicon plasmid pHB42-1
Accession NZ_CP104078
Organism Escherichia coli strain HB42

Toxin (Protein)


Gene name hok Uniprot ID G9G195
Locus tag N0M81_RS23100 Protein ID WP_001323520.1
Coordinates 115934..116050 (+) Length 39 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 115781..115846 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0M81_RS23045 111000..111971 + 972 WP_000817028.1 ParB/RepB/Spo0J family plasmid partition protein -
N0M81_RS23050 112608..112777 + 170 Protein_116 hypothetical protein -
N0M81_RS23055 112960..113040 - 81 Protein_117 hypothetical protein -
N0M81_RS23060 113110..113316 + 207 WP_000275856.1 hypothetical protein -
N0M81_RS23065 113342..113881 + 540 WP_000290840.1 single-stranded DNA-binding protein -
N0M81_RS23070 113949..114182 + 234 WP_000005987.1 DUF905 family protein -
N0M81_RS23075 114210..114407 + 198 Protein_121 hypothetical protein -
N0M81_RS23080 114462..114896 + 435 WP_000845936.1 conjugation system SOS inhibitor PsiB -
N0M81_RS23085 114893..115655 + 763 Protein_123 plasmid SOS inhibition protein A -
N0M81_RS23090 115624..115812 - 189 WP_001299721.1 hypothetical protein -
- 115624..115848 + 225 NuclAT_0 - -
- 115624..115848 + 225 NuclAT_0 - -
- 115624..115848 + 225 NuclAT_0 - -
- 115624..115848 + 225 NuclAT_0 - -
- 115781..115846 - 66 - - Antitoxin
N0M81_RS23095 115834..115983 + 150 Protein_125 plasmid maintenance protein Mok -
N0M81_RS23100 115934..116050 + 117 WP_001323520.1 type I toxin-antitoxin system Hok family toxin Toxin
N0M81_RS23105 116270..116500 + 231 WP_071586998.1 hypothetical protein -
N0M81_RS23110 116498..116670 - 173 Protein_128 hypothetical protein -
N0M81_RS23115 116740..116946 + 207 WP_000547968.1 hypothetical protein -
N0M81_RS23120 116971..117258 + 288 WP_000107535.1 hypothetical protein -
N0M81_RS23125 117376..118197 + 822 WP_001234426.1 DUF932 domain-containing protein -
N0M81_RS23130 118494..119096 - 603 WP_000243712.1 transglycosylase SLT domain-containing protein -
N0M81_RS23135 119417..119800 + 384 WP_001151524.1 conjugal transfer relaxosome DNA-binding protein TraM -
N0M81_RS23140 119987..120676 + 690 WP_000283385.1 conjugal transfer transcriptional regulator TraJ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aac(3)-IId / mph(A) / fosA3 / blaCTX-M-14 / sitABCD iroN / iroE / iroD / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..154403 154403


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(1-34)


Sequences

Toxin        


Download         Length: 39 a.a.        Molecular weight: 4455.23 Da        Isoelectric Point: 8.5110

>T257138 WP_001323520.1 NZ_CP104078:115934-116050 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Download         Length: 117 bp

Antitoxin


Download         Length: 66 bp

>AT257138 NZ_CP104078:c115846-115781 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G9G195

Antitoxin

Download structure file

References