Detailed information of TA system TA257137

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 115624..116050
• Replicon: plasmid pHB42-1
• Accession: NZ_CP104078
• Organism: Escherichia coli strain HB42

Toxin (Protein)

• Gene name: hok
• Uniprot ID: G9G195
• Locus tag: N0M81_RS23100
• Protein ID: WP_001323520.1
• Coordinates: 115934..116050 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	115624..115848 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N0M81_RS23045 (111000)	111000..111971	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
N0M81_RS23050 (112608)	112608..112777	+	170	Protein_116	hypothetical protein	-
N0M81_RS23055 (112960)	112960..113040	-	81	Protein_117	hypothetical protein	-
N0M81_RS23060 (113110)	113110..113316	+	207	WP_000275856.1	hypothetical protein	-
N0M81_RS23065 (113342)	113342..113881	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
N0M81_RS23070 (113949)	113949..114182	+	234	WP_000005987.1	DUF905 family protein	-
N0M81_RS23075 (114210)	114210..114407	+	198	Protein_121	hypothetical protein	-
N0M81_RS23080 (114462)	114462..114896	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
N0M81_RS23085 (114893)	114893..115655	+	763	Protein_123	plasmid SOS inhibition protein A	-
N0M81_RS23090 (115624)	115624..115812	-	189	WP_001299721.1	hypothetical protein	-
- (115624)	115624..115848	+	225	NuclAT_0	-	Antitoxin
- (115624)	115624..115848	+	225	NuclAT_0	-	Antitoxin
- (115624)	115624..115848	+	225	NuclAT_0	-	Antitoxin
- (115624)	115624..115848	+	225	NuclAT_0	-	Antitoxin
N0M81_RS23095 (115834)	115834..115983	+	150	Protein_125	plasmid maintenance protein Mok	-
N0M81_RS23100 (115934)	115934..116050	+	117	WP_001323520.1	type I toxin-antitoxin system Hok family toxin	Toxin
N0M81_RS23105 (116270)	116270..116500	+	231	WP_071586998.1	hypothetical protein	-
N0M81_RS23110 (116498)	116498..116670	-	173	Protein_128	hypothetical protein	-
N0M81_RS23115 (116740)	116740..116946	+	207	WP_000547968.1	hypothetical protein	-
N0M81_RS23120 (116971)	116971..117258	+	288	WP_000107535.1	hypothetical protein	-
N0M81_RS23125 (117376)	117376..118197	+	822	WP_001234426.1	DUF932 domain-containing protein	-
N0M81_RS23130 (118494)	118494..119096	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
N0M81_RS23135 (119417)	119417..119800	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N0M81_RS23140 (119987)	119987..120676	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / aac(3)-IId / mph(A) / fosA3 / blaCTX-M-14 / sitABCD	iroN / iroE / iroD / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA	1..154403	154403

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (1-34)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4455.23 Da
• Isoelectric Point: 8.5110

>T257137 WP_001323520.1 NZ_CP104078:115934-116050 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 117 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT257137 NZ_CP104078:115624-115848 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Toxin

• AlphaFold DB: G9G195

Antitoxin