Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 678805..679604 | Replicon | chromosome |
Accession | NZ_CP104077 | ||
Organism | Escherichia coli strain HB42 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | N0M81_RS03305 | Protein ID | WP_000347273.1 |
Coordinates | 678805..679269 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | D6JF08 |
Locus tag | N0M81_RS03310 | Protein ID | WP_001308975.1 |
Coordinates | 679269..679604 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0M81_RS03275 (673806) | 673806..674240 | - | 435 | WP_000948834.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
N0M81_RS03280 (674258) | 674258..675136 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N0M81_RS03285 (675126) | 675126..675905 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N0M81_RS03290 (675916) | 675916..676389 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N0M81_RS03295 (676412) | 676412..677692 | - | 1281 | WP_000681961.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N0M81_RS03300 (677941) | 677941..678750 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
N0M81_RS03305 (678805) | 678805..679269 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N0M81_RS03310 (679269) | 679269..679604 | - | 336 | WP_001308975.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N0M81_RS03315 (679753) | 679753..681324 | - | 1572 | WP_001273756.1 | galactarate dehydratase | - |
N0M81_RS03320 (681699) | 681699..683033 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
N0M81_RS03325 (683049) | 683049..683819 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 678805..690085 | 11280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T257116 WP_000347273.1 NZ_CP104077:c679269-678805 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|