Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4194294..4194896 | Replicon | chromosome |
Accession | NZ_CP104049 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain Sal-FJ2064 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A603E470 |
Locus tag | NXZ70_RS20525 | Protein ID | WP_023138876.1 |
Coordinates | 4194294..4194605 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NXZ70_RS20530 | Protein ID | WP_000362052.1 |
Coordinates | 4194606..4194896 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NXZ70_RS20490 (4189407) | 4189407..4190006 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
NXZ70_RS20495 (4190000) | 4190000..4190872 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
NXZ70_RS20500 (4190869) | 4190869..4191306 | + | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
NXZ70_RS20505 (4191351) | 4191351..4192292 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
NXZ70_RS20510 (4192307) | 4192307..4192753 | - | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
NXZ70_RS20515 (4192750) | 4192750..4193061 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
NXZ70_RS20520 (4193147) | 4193147..4194076 | - | 930 | WP_001127698.1 | alpha/beta hydrolase | - |
NXZ70_RS20525 (4194294) | 4194294..4194605 | + | 312 | WP_023138876.1 | hypothetical protein | Toxin |
NXZ70_RS20530 (4194606) | 4194606..4194896 | + | 291 | WP_000362052.1 | DNA-binding transcriptional regulator | Antitoxin |
NXZ70_RS20535 (4194943) | 4194943..4195872 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
NXZ70_RS20540 (4195869) | 4195869..4196504 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
NXZ70_RS20545 (4196501) | 4196501..4197403 | - | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12356.30 Da Isoelectric Point: 9.4460
>T257106 WP_023138876.1 NZ_CP104049:4194294-4194605 [Salmonella enterica subsp. enterica serovar Kentucky]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10970.65 Da Isoelectric Point: 11.0303
>AT257106 WP_000362052.1 NZ_CP104049:4194606-4194896 [Salmonella enterica subsp. enterica serovar Kentucky]
MDKVLFERLTQSMSQMNEIIEGTRKPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTRKPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|