Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/- |
| Location | 3609813..3610467 | Replicon | chromosome |
| Accession | NZ_CP104045 | ||
| Organism | Pseudomonas sp. FJ2-5-13 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N2A98_RS15820 | Protein ID | WP_003192123.1 |
| Coordinates | 3609813..3610163 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1T1HTP3 |
| Locus tag | N2A98_RS15825 | Protein ID | WP_044274604.1 |
| Coordinates | 3610153..3610467 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2A98_RS15810 (N2A98_15830) | 3606571..3608103 | + | 1533 | WP_014718913.1 | NADH-quinone oxidoreductase subunit M | - |
| N2A98_RS15815 (N2A98_15835) | 3608111..3609574 | + | 1464 | WP_003192122.1 | NADH-quinone oxidoreductase subunit NuoN | - |
| N2A98_RS15820 (N2A98_15840) | 3609813..3610163 | + | 351 | WP_003192123.1 | toxin | Toxin |
| N2A98_RS15825 (N2A98_15845) | 3610153..3610467 | + | 315 | WP_044274604.1 | hypothetical protein | Antitoxin |
| N2A98_RS15830 (N2A98_15850) | 3610529..3611281 | - | 753 | WP_044274605.1 | outer membrane beta-barrel protein | - |
| N2A98_RS15835 (N2A98_15855) | 3611407..3612240 | - | 834 | WP_044274606.1 | arylamine N-acetyltransferase | - |
| N2A98_RS15840 (N2A98_15860) | 3612361..3612597 | + | 237 | WP_003192128.1 | hypothetical protein | - |
| N2A98_RS15845 (N2A98_15865) | 3612628..3612828 | - | 201 | WP_044274607.1 | DUF6021 family protein | - |
| N2A98_RS15850 (N2A98_15870) | 3612841..3613020 | - | 180 | WP_044274608.1 | hypothetical protein | - |
| N2A98_RS15855 (N2A98_15875) | 3613135..3613656 | + | 522 | WP_044274609.1 | DUF3087 family protein | - |
| N2A98_RS15860 (N2A98_15880) | 3613786..3614499 | + | 714 | WP_228391104.1 | carbonic anhydrase | - |
| N2A98_RS15865 (N2A98_15885) | 3614506..3614592 | - | 87 | Protein_3129 | outer membrane lipoprotein carrier protein LolA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13826.71 Da Isoelectric Point: 9.7551
>T257089 WP_003192123.1 NZ_CP104045:3609813-3610163 [Pseudomonas sp. FJ2-5-13]
MDALFIELPAFERHRRDYLSDELFHGFQQELMKNPEAGDVIEGTGGLRKVRFVDERRNKGKRGGLRVIYYWWSGGTQFWL
FTLYGKHEQNDLTPQHKKALKHMLDREIKARTHHET
MDALFIELPAFERHRRDYLSDELFHGFQQELMKNPEAGDVIEGTGGLRKVRFVDERRNKGKRGGLRVIYYWWSGGTQFWL
FTLYGKHEQNDLTPQHKKALKHMLDREIKARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|