Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-YefM |
| Location | 60624..61149 | Replicon | plasmid pWSM4643_3 |
| Accession | NZ_CP104043 | ||
| Organism | Rhizobium leguminosarum bv. viciae strain WSM4643 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | N1937_RS29745 | Protein ID | WP_170277613.1 |
| Coordinates | 60877..61149 (+) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | N1937_RS29740 | Protein ID | WP_162115192.1 |
| Coordinates | 60624..60875 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1937_RS29730 (N1937_29730) | 57151..58494 | - | 1344 | WP_026154574.1 | adenylate/guanylate cyclase domain-containing protein | - |
| N1937_RS29735 (N1937_29735) | 59153..60490 | + | 1338 | WP_260060366.1 | nucleotide sugar dehydrogenase | - |
| N1937_RS29740 (N1937_29740) | 60624..60875 | + | 252 | WP_162115192.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| N1937_RS29745 (N1937_29745) | 60877..61149 | + | 273 | WP_170277613.1 | Txe/YoeB family addiction module toxin | Toxin |
| N1937_RS29750 (N1937_29750) | 61204..62379 | - | 1176 | WP_260060367.1 | DUF3095 domain-containing protein | - |
| N1937_RS29755 (N1937_29755) | 62604..63083 | + | 480 | WP_260060368.1 | class I SAM-dependent methyltransferase | - |
| N1937_RS29760 (N1937_29760) | 63211..65001 | - | 1791 | WP_222386856.1 | ABC transporter ATP-binding protein | - |
| N1937_RS29765 (N1937_29765) | 65423..65878 | - | 456 | WP_260060369.1 | Rrf2 family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..407296 | 407296 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10792.50 Da Isoelectric Point: 9.7234
>T257082 WP_170277613.1 NZ_CP104043:60877-61149 [Rhizobium leguminosarum bv. viciae]
MKLLWTPNSWKEYEYWQKSDQKMVEKINELLKDTKRSAFKVLGKPEPLKGDLSGFWSRRILGEHRLVYCVTGKGSDQQLE
IIQCRFHYEK
MKLLWTPNSWKEYEYWQKSDQKMVEKINELLKDTKRSAFKVLGKPEPLKGDLSGFWSRRILGEHRLVYCVTGKGSDQQLE
IIQCRFHYEK
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|