Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-YefM |
Location | 61493..62018 | Replicon | plasmid pSRDI969_3 |
Accession | NZ_CP104038 | ||
Organism | Rhizobium leguminosarum bv. viciae strain SRDI969 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | N2A41_RS29925 | Protein ID | WP_017968210.1 |
Coordinates | 61746..62018 (+) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | N2A41_RS29920 | Protein ID | WP_260111936.1 |
Coordinates | 61493..61744 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2A41_RS29910 (N2A41_29910) | 58170..59513 | - | 1344 | WP_260111934.1 | adenylate/guanylate cyclase domain-containing protein | - |
N2A41_RS29915 (N2A41_29915) | 60022..61359 | + | 1338 | WP_260111935.1 | nucleotide sugar dehydrogenase | - |
N2A41_RS29920 (N2A41_29920) | 61493..61744 | + | 252 | WP_260111936.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
N2A41_RS29925 (N2A41_29925) | 61746..62018 | + | 273 | WP_017968210.1 | Txe/YoeB family addiction module toxin | Toxin |
N2A41_RS29930 (N2A41_29930) | 62073..63248 | - | 1176 | WP_260111937.1 | DUF3095 domain-containing protein | - |
N2A41_RS29935 (N2A41_29935) | 63473..63952 | + | 480 | WP_260111938.1 | class I SAM-dependent methyltransferase | - |
N2A41_RS29940 (N2A41_29940) | 64081..65871 | - | 1791 | WP_260111939.1 | ABC transporter ATP-binding protein | - |
N2A41_RS29945 (N2A41_29945) | 66293..66748 | - | 456 | WP_260111940.1 | Rrf2 family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..427026 | 427026 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10877.52 Da Isoelectric Point: 8.4756
>T257075 WP_017968210.1 NZ_CP104038:61746-62018 [Rhizobium leguminosarum bv. viciae]
MKLLWTPNSWEEYEYWQKSDQKMVEKINELLKDTKRSPFKVLDKPEPLKGDLSGFWSRRILGEHRLVYCVTGKGSDQQLE
IIQCRFHYEK
MKLLWTPNSWEEYEYWQKSDQKMVEKINELLKDTKRSPFKVLDKPEPLKGDLSGFWSRRILGEHRLVYCVTGKGSDQQLE
IIQCRFHYEK
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|