Detailed information of TA system TA257059

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 109740..110009
• Replicon: plasmid pCTXM65_150040X0B1
• Accession: NZ_CP104031
• Organism: Klebsiella pneumoniae strain 150040X0B1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N1940_RS27585
• Protein ID: WP_001372321.1
• Coordinates: 109884..110009 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	109740..109805 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N1940_RS27555	105450..105977	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
N1940_RS27560	106035..106268	+	234	WP_000006003.1	DUF905 family protein	-
N1940_RS27565	106329..108352	+	2024	Protein_143	ParB/RepB/Spo0J family partition protein	-
N1940_RS27570	108421..108855	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
N1940_RS27575	108852..109571	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	109583..109807	+	225	NuclAT_0	-	-
-	109583..109807	+	225	NuclAT_0	-	-
-	109583..109807	+	225	NuclAT_0	-	-
-	109583..109807	+	225	NuclAT_0	-	-
-	109740..109805	-	66	-	-	Antitoxin
N1940_RS27580	109793..109942	+	150	Protein_146	plasmid maintenance protein Mok	-
N1940_RS27585	109884..110009	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N1940_RS27590	110328..110624	-	297	Protein_148	hypothetical protein	-
N1940_RS27595	110924..111220	+	297	WP_001272251.1	hypothetical protein	-
N1940_RS27600	111331..112152	+	822	WP_001234445.1	DUF932 domain-containing protein	-
N1940_RS27605	112449..113096	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
N1940_RS27610	113373..113756	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N1940_RS27615	113947..114633	+	687	WP_015059009.1	PAS domain-containing protein	-
N1940_RS27620	114727..114954	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-65	-	1..178278	178278

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T257059 WP_001372321.1 NZ_CP104031:109884-110009 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT257059 NZ_CP104031:c109805-109740 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin