Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 109583..110009 | Replicon | plasmid pCTXM65_150040X0B1 |
| Accession | NZ_CP104031 | ||
| Organism | Klebsiella pneumoniae strain 150040X0B1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | N1940_RS27585 | Protein ID | WP_001372321.1 |
| Coordinates | 109884..110009 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 109583..109807 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1940_RS27550 (104687) | 104687..105148 | - | 462 | Protein_140 | hypothetical protein | - |
| N1940_RS27555 (105450) | 105450..105977 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| N1940_RS27560 (106035) | 106035..106268 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| N1940_RS27565 (106329) | 106329..108352 | + | 2024 | Protein_143 | ParB/RepB/Spo0J family partition protein | - |
| N1940_RS27570 (108421) | 108421..108855 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| N1940_RS27575 (108852) | 108852..109571 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - (109583) | 109583..109807 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (109583) | 109583..109807 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (109583) | 109583..109807 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (109583) | 109583..109807 | + | 225 | NuclAT_0 | - | Antitoxin |
| N1940_RS27580 (109793) | 109793..109942 | + | 150 | Protein_146 | plasmid maintenance protein Mok | - |
| N1940_RS27585 (109884) | 109884..110009 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| N1940_RS27590 (110328) | 110328..110624 | - | 297 | Protein_148 | hypothetical protein | - |
| N1940_RS27595 (110924) | 110924..111220 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| N1940_RS27600 (111331) | 111331..112152 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| N1940_RS27605 (112449) | 112449..113096 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| N1940_RS27610 (113373) | 113373..113756 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| N1940_RS27615 (113947) | 113947..114633 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| N1940_RS27620 (114727) | 114727..114954 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-65 | - | 1..178278 | 178278 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T257058 WP_001372321.1 NZ_CP104031:109884-110009 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT257058 NZ_CP104031:109583-109807 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|