Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2723518..2723797 | Replicon | chromosome |
Accession | NZ_CP104020 | ||
Organism | Staphylococcus aureus strain 0831 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | N0J69_RS13575 | Protein ID | WP_001802298.1 |
Coordinates | 2723518..2723622 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2723618..2723797 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0J69_RS13545 | 2718902..2719684 | + | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
N0J69_RS13550 | 2719752..2720609 | + | 858 | WP_000370924.1 | HAD family hydrolase | - |
N0J69_RS13555 | 2720841..2721025 | - | 185 | Protein_2633 | exotoxin | - |
N0J69_RS13560 | 2721314..2721406 | - | 93 | WP_001790138.1 | hypothetical protein | - |
N0J69_RS13565 | 2721695..2722831 | + | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
N0J69_RS13570 | 2722874..2723357 | + | 484 | Protein_2636 | recombinase family protein | - |
N0J69_RS13575 | 2723518..2723622 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 2723618..2723797 | - | 180 | - | - | Antitoxin |
N0J69_RS13585 | 2724122..2725213 | - | 1092 | WP_000495671.1 | lytic regulatory protein | - |
N0J69_RS13590 | 2725479..2726459 | - | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
N0J69_RS13595 | 2726461..2726781 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
N0J69_RS13600 | 2726933..2727598 | + | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T257020 WP_001802298.1 NZ_CP104020:2723518-2723622 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT257020 NZ_CP104020:c2723797-2723618 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|