Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2433485..2433669 | Replicon | chromosome |
Accession | NZ_CP104020 | ||
Organism | Staphylococcus aureus strain 0831 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | N0J69_RS12050 | Protein ID | WP_000482650.1 |
Coordinates | 2433485..2433592 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2433609..2433669 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0J69_RS12025 | 2428847..2429320 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
N0J69_RS12030 | 2429443..2430654 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
N0J69_RS12035 | 2430836..2431495 | - | 660 | WP_000831298.1 | membrane protein | - |
N0J69_RS12040 | 2431555..2432697 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
N0J69_RS12045 | 2432965..2433351 | + | 387 | WP_000779358.1 | flippase GtxA | - |
N0J69_RS12050 | 2433485..2433592 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2433609..2433669 | - | 61 | - | - | Antitoxin |
N0J69_RS12055 | 2434220..2435983 | + | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein | - |
N0J69_RS12060 | 2436008..2437741 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
N0J69_RS12065 | 2437972..2438139 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T257017 WP_000482650.1 NZ_CP104020:2433485-2433592 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT257017 NZ_CP104020:c2433669-2433609 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|