Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 179937..180119 | Replicon | chromosome |
| Accession | NZ_CP104020 | ||
| Organism | Staphylococcus aureus strain 0831 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | N0J69_RS01085 | Protein ID | WP_001801861.1 |
| Coordinates | 180024..180119 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 179937..179996 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0J69_RS01070 | 179075..179452 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| N0J69_RS01075 | 179646..179822 | + | 177 | Protein_175 | transposase | - |
| N0J69_RS01080 | 179800..179901 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 179937..179996 | + | 60 | - | - | Antitoxin |
| N0J69_RS01085 | 180024..180119 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| N0J69_RS01090 | 180322..180465 | + | 144 | WP_001549059.1 | transposase | - |
| N0J69_RS01095 | 181069..181452 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| N0J69_RS01100 | 181463..181639 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| N0J69_RS01105 | 181641..181826 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| N0J69_RS01110 | 181940..182581 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| N0J69_RS01115 | 182799..183350 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| N0J69_RS01120 | 183448..183792 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| N0J69_RS01125 | 183833..184459 | - | 627 | Protein_185 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlgA / lukD | 146848..206145 | 59297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T257014 WP_001801861.1 NZ_CP104020:c180119-180024 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT257014 NZ_CP104020:179937-179996 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|