Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 18831..19138 | Replicon | chromosome |
| Accession | NZ_CP104020 | ||
| Organism | Staphylococcus aureus strain 0831 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | N0J69_RS00105 | Protein ID | WP_011447039.1 |
| Coordinates | 18831..19007 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 18999..19138 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0J69_RS00085 (14066) | 14066..17851 | + | 3786 | WP_000582165.1 | phage tail spike protein | - |
| N0J69_RS00090 (17841) | 17841..17993 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| N0J69_RS00095 (18040) | 18040..18327 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| N0J69_RS00100 (18385) | 18385..18681 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| N0J69_RS00105 (18831) | 18831..19007 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (18999) | 18999..19138 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (18999) | 18999..19138 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (18999) | 18999..19138 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (18999) | 18999..19138 | - | 140 | NuclAT_0 | - | Antitoxin |
| N0J69_RS00110 (19060) | 19060..19167 | - | 108 | WP_001791821.1 | hypothetical protein | - |
| N0J69_RS00115 (19219) | 19219..19473 | + | 255 | WP_000611512.1 | phage holin | - |
| N0J69_RS00120 (19485) | 19485..20240 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| N0J69_RS00125 (20431) | 20431..20922 | + | 492 | WP_000919350.1 | staphylokinase | - |
| N0J69_RS00130 (21572) | 21572..21907 | + | 336 | Protein_25 | SH3 domain-containing protein | - |
| N0J69_RS00135 (22002) | 22002..22451 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| N0J69_RS00140 (23136) | 23136..23486 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| N0J69_RS00145 (23539) | 23539..23799 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sak / chp / scn | 1..23486 | 23485 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T257012 WP_011447039.1 NZ_CP104020:18831-19007 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT257012 NZ_CP104020:c19138-18999 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
