Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 18831..19169 | Replicon | chromosome |
Accession | NZ_CP104020 | ||
Organism | Staphylococcus aureus strain 0831 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | N0J69_RS00105 | Protein ID | WP_011447039.1 |
Coordinates | 18831..19007 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 18995..19169 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0J69_RS00085 | 14066..17851 | + | 3786 | WP_000582165.1 | phage tail spike protein | - |
N0J69_RS00090 | 17841..17993 | + | 153 | WP_001153681.1 | hypothetical protein | - |
N0J69_RS00095 | 18040..18327 | + | 288 | WP_001040261.1 | hypothetical protein | - |
N0J69_RS00100 | 18385..18681 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
N0J69_RS00105 | 18831..19007 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 18995..19169 | - | 175 | - | - | Antitoxin |
N0J69_RS00115 | 19219..19473 | + | 255 | WP_000611512.1 | phage holin | - |
N0J69_RS00120 | 19485..20240 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
N0J69_RS00125 | 20431..20922 | + | 492 | WP_000919350.1 | staphylokinase | - |
N0J69_RS00130 | 21572..21907 | + | 336 | Protein_25 | SH3 domain-containing protein | - |
N0J69_RS00135 | 22002..22451 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
N0J69_RS00140 | 23136..23486 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
N0J69_RS00145 | 23539..23799 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sak / chp / scn | 1..23486 | 23485 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T257010 WP_011447039.1 NZ_CP104020:18831-19007 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT257010 NZ_CP104020:c19169-18995 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|