Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4706210..4706812 | Replicon | chromosome |
Accession | NZ_CP104014 | ||
Organism | Enterobacter sp. CP102 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N1249_RS22230 | Protein ID | WP_259833481.1 |
Coordinates | 4706501..4706812 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N1249_RS22225 | Protein ID | WP_259833479.1 |
Coordinates | 4706210..4706500 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1249_RS22210 (N1249_22210) | 4703708..4704610 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
N1249_RS22215 (N1249_22215) | 4704607..4705242 | + | 636 | WP_008501832.1 | formate dehydrogenase cytochrome b556 subunit | - |
N1249_RS22220 (N1249_22220) | 4705239..4706168 | + | 930 | WP_014072388.1 | formate dehydrogenase accessory protein FdhE | - |
N1249_RS22225 (N1249_22225) | 4706210..4706500 | - | 291 | WP_259833479.1 | NadS family protein | Antitoxin |
N1249_RS22230 (N1249_22230) | 4706501..4706812 | - | 312 | WP_259833481.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N1249_RS22235 (N1249_22235) | 4707042..4707959 | + | 918 | WP_259833483.1 | alpha/beta hydrolase | - |
N1249_RS22240 (N1249_22240) | 4707976..4708917 | - | 942 | WP_259833486.1 | fatty acid biosynthesis protein FabY | - |
N1249_RS22245 (N1249_22245) | 4708962..4709399 | - | 438 | WP_014072393.1 | D-aminoacyl-tRNA deacylase | - |
N1249_RS22250 (N1249_22250) | 4709396..4710277 | - | 882 | WP_259833488.1 | virulence factor BrkB family protein | - |
N1249_RS22255 (N1249_22255) | 4710271..4710870 | - | 600 | WP_014072395.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12173.29 Da Isoelectric Point: 9.9665
>T257009 WP_259833481.1 NZ_CP104014:c4706812-4706501 [Enterobacter sp. CP102]
MLFIETEIFTEDVKLLLDDDEYRKLQVFLAMQPDYGDLIQNTGGLRKIRWLAGGKGKRGGVRVIYFHRTREFEIRLLLIY
RKGIKDDLSATEKAVLKKIIERW
MLFIETEIFTEDVKLLLDDDEYRKLQVFLAMQPDYGDLIQNTGGLRKIRWLAGGKGKRGGVRVIYFHRTREFEIRLLLIY
RKGIKDDLSATEKAVLKKIIERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|