Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1164214..1164863 | Replicon | chromosome |
Accession | NZ_CP104014 | ||
Organism | Enterobacter sp. CP102 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N1249_RS05450 | Protein ID | WP_259835152.1 |
Coordinates | 1164501..1164863 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N1249_RS05445 | Protein ID | WP_259835150.1 |
Coordinates | 1164214..1164513 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1249_RS05430 (N1249_05430) | 1159250..1160332 | + | 1083 | WP_259835144.1 | SMP-30/gluconolactonase/LRE family protein | - |
N1249_RS05435 (N1249_05435) | 1160386..1162572 | + | 2187 | WP_259835146.1 | TonB-dependent siderophore receptor | - |
N1249_RS05440 (N1249_05440) | 1162675..1164063 | + | 1389 | WP_259835148.1 | phenylalanine transporter | - |
N1249_RS05445 (N1249_05445) | 1164214..1164513 | - | 300 | WP_259835150.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N1249_RS05450 (N1249_05450) | 1164501..1164863 | - | 363 | WP_259835152.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N1249_RS05455 (N1249_05455) | 1165070..1166308 | + | 1239 | WP_259835154.1 | MFS transporter | - |
N1249_RS05460 (N1249_05460) | 1166324..1167349 | + | 1026 | WP_259835163.1 | sugar phosphate isomerase/epimerase | - |
N1249_RS05465 (N1249_05465) | 1167342..1168484 | + | 1143 | WP_259835165.1 | Gfo/Idh/MocA family oxidoreductase | - |
N1249_RS05470 (N1249_05470) | 1168560..1169531 | + | 972 | WP_259835167.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13908.98 Da Isoelectric Point: 7.3223
>T257002 WP_259835152.1 NZ_CP104014:c1164863-1164501 [Enterobacter sp. CP102]
MWDIETTDRFDKWFFNQTLALKEDVLAAMHILAEFGPQLGRPYVDTVKASAYPNMKELRIQHSGDPIRAFFAFDPRRTAI
VLCAGDKSGCVEKRFYNEMIKLADAEFSKHLANKEAIWHR
MWDIETTDRFDKWFFNQTLALKEDVLAAMHILAEFGPQLGRPYVDTVKASAYPNMKELRIQHSGDPIRAFFAFDPRRTAI
VLCAGDKSGCVEKRFYNEMIKLADAEFSKHLANKEAIWHR
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|