Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 56572..57280 | Replicon | chromosome |
Accession | NZ_CP104006 | ||
Organism | Yersinia alsatica strain SCPM-O-B-7604 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0T9UP84 |
Locus tag | N0H69_RS00250 | Protein ID | WP_050109236.1 |
Coordinates | 56960..57280 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N0H69_RS00245 | Protein ID | WP_050109237.1 |
Coordinates | 56572..56910 (-) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0H69_RS00215 (N0H69_00215) | 51664..52020 | + | 357 | WP_050109241.1 | YibL family ribosome-associated protein | - |
N0H69_RS00220 (N0H69_00220) | 52086..52409 | - | 324 | WP_253272122.1 | type II toxin-antitoxin system YafQ family toxin | - |
N0H69_RS00225 (N0H69_00225) | 52387..52668 | - | 282 | WP_050123827.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
N0H69_RS00230 (N0H69_00230) | 52753..53445 | - | 693 | WP_050151868.1 | 6-hydroxyaminopurine reductase | - |
N0H69_RS00235 (N0H69_00235) | 53524..55482 | - | 1959 | WP_050151870.1 | methyl-accepting chemotaxis protein | - |
N0H69_RS00240 (N0H69_00240) | 55770..56393 | - | 624 | WP_050099416.1 | superoxide dismutase [Mn] | - |
N0H69_RS00245 (N0H69_00245) | 56572..56910 | - | 339 | WP_050109237.1 | HigA family addiction module antitoxin | Antitoxin |
N0H69_RS00250 (N0H69_00250) | 56960..57280 | - | 321 | WP_050109236.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N0H69_RS00255 (N0H69_00255) | 57356..58207 | - | 852 | WP_172665459.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
N0H69_RS00260 (N0H69_00260) | 58516..61563 | + | 3048 | WP_151420028.1 | formate dehydrogenase-N subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12397.08 Da Isoelectric Point: 10.1709
>T256979 WP_050109236.1 NZ_CP104006:c57280-56960 [Yersinia alsatica]
MDKHKKRSIGSFRDTWLEGFFEHGGRHRKIPASIENVLARKLDIINAAISYKDLRSPPANRYEELNPPLEGYSSIRINDQ
YRLIFVWANGKANDLYLDAHGYKKHR
MDKHKKRSIGSFRDTWLEGFFEHGGRHRKIPASIENVLARKLDIINAAISYKDLRSPPANRYEELNPPLEGYSSIRINDQ
YRLIFVWANGKANDLYLDAHGYKKHR
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|