Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 103148..103402 Replicon plasmid pDLI.6n
Accession NZ_CP103975
Organism Escherichia coli strain DLI.6n

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NZ657_RS24900 Protein ID WP_001312851.1
Coordinates 103253..103402 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 103148..103209 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NZ657_RS24875 (100324) 100324..101070 + 747 WP_000205718.1 conjugal transfer pilus acetylase TraX -
NZ657_RS24880 (101125) 101125..101685 + 561 WP_000139325.1 fertility inhibition protein FinO -
NZ657_RS24885 (101817) 101817..102029 + 213 WP_001301409.1 ANR family transcriptional regulator -
NZ657_RS24890 (102274) 102274..102360 + 87 Protein_117 endonuclease -
NZ657_RS24895 (102541) 102541..102852 - 312 WP_000802277.1 hypothetical protein -
- (103148) 103148..103209 - 62 NuclAT_0 - Antitoxin
- (103148) 103148..103209 - 62 NuclAT_0 - Antitoxin
- (103148) 103148..103209 - 62 NuclAT_0 - Antitoxin
- (103148) 103148..103209 - 62 NuclAT_0 - Antitoxin
NZ657_RS24900 (103253) 103253..103402 + 150 WP_001312851.1 Hok/Gef family protein Toxin
NZ657_RS24905 (103686) 103686..103943 + 258 WP_000083845.1 replication regulatory protein RepA -
NZ657_RS24910 (104046) 104046..104232 + 187 Protein_121 protein CopA/IncA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) - 1..104244 104244


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T256956 WP_001312851.1 NZ_CP103975:103253-103402 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT256956 NZ_CP103975:c103209-103148 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References