Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 633551..634350 | Replicon | chromosome |
| Accession | NZ_CP103974 | ||
| Organism | Escherichia coli strain DLI.6n | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
| Locus tag | NZ657_RS03070 | Protein ID | WP_000347275.1 |
| Coordinates | 633551..634015 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | NZ657_RS03075 | Protein ID | WP_001307405.1 |
| Coordinates | 634015..634350 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZ657_RS03040 (628552) | 628552..628986 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NZ657_RS03045 (629004) | 629004..629882 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NZ657_RS03050 (629872) | 629872..630651 | - | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NZ657_RS03055 (630662) | 630662..631135 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NZ657_RS03060 (631158) | 631158..632438 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NZ657_RS03065 (632687) | 632687..633496 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NZ657_RS03070 (633551) | 633551..634015 | - | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NZ657_RS03075 (634015) | 634015..634350 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NZ657_RS03080 (634499) | 634499..636070 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| NZ657_RS03085 (636445) | 636445..637779 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NZ657_RS03090 (637795) | 637795..638565 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T256936 WP_000347275.1 NZ_CP103974:c634015-633551 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A6SPA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |