Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3836306..3837000 | Replicon | chromosome |
| Accession | NZ_CP103972 | ||
| Organism | Escherichia coli strain DLI.5a | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | NZD79_RS18680 | Protein ID | WP_001263489.1 |
| Coordinates | 3836602..3837000 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | NZD79_RS18675 | Protein ID | WP_000554758.1 |
| Coordinates | 3836306..3836599 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZD79_RS18655 (3831938) | 3831938..3832435 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
| NZD79_RS18660 (3832659) | 3832659..3834371 | - | 1713 | Protein_3638 | flagellar biosynthesis protein FlhA | - |
| NZD79_RS18665 (3834343) | 3834343..3835128 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| NZD79_RS18670 (3835199) | 3835199..3836254 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| NZD79_RS18675 (3836306) | 3836306..3836599 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NZD79_RS18680 (3836602) | 3836602..3837000 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NZD79_RS18685 (3837079) | 3837079..3837776 | + | 698 | WP_248783592.1 | IS1 family transposase | - |
| NZD79_RS18690 (3837778) | 3837778..3838239 | + | 462 | WP_259568154.1 | GNAT family N-acetyltransferase | - |
| NZD79_RS18695 (3838557) | 3838557..3838763 | + | 207 | Protein_3645 | RtcB family protein | - |
| NZD79_RS18700 (3838759) | 3838759..3839280 | + | 522 | Protein_3646 | peptide chain release factor H | - |
| NZD79_RS18705 (3839337) | 3839337..3840794 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| NZD79_RS18710 (3841055) | 3841055..3841513 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3831136..3869504 | 38368 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T256933 WP_001263489.1 NZ_CP103972:3836602-3837000 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |