Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 1994405..1995098 | Replicon | chromosome |
| Accession | NZ_CP103972 | ||
| Organism | Escherichia coli strain DLI.5a | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | NZD79_RS09740 | Protein ID | WP_000415584.1 |
| Coordinates | 1994802..1995098 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | NZD79_RS09735 | Protein ID | WP_000650107.1 |
| Coordinates | 1994405..1994800 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZD79_RS09725 (1990269) | 1990269..1992527 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
| NZD79_RS09730 (1992665) | 1992665..1994272 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| NZD79_RS09735 (1994405) | 1994405..1994800 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| NZD79_RS09740 (1994802) | 1994802..1995098 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| NZD79_RS09745 (1995303) | 1995303..1995785 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| NZD79_RS09750 (1995838) | 1995838..1996230 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| NZD79_RS09755 (1996382) | 1996382..1997041 | + | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| NZD79_RS09760 (1997038) | 1997038..1998387 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| NZD79_RS09765 (1998433) | 1998433..1998765 | - | 333 | WP_000917685.1 | DUF2645 family protein | - |
| NZD79_RS09770 (1999084) | 1999084..1999665 | + | 582 | WP_259568214.1 | NADPH:quinone oxidoreductase MdaB | - |
| NZD79_RS09775 (1999696) | 1999696..2000010 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T256928 WP_000415584.1 NZ_CP103972:c1995098-1994802 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT256928 WP_000650107.1 NZ_CP103972:c1994800-1994405 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|