Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 62649..63349 | Replicon | plasmid unnamed |
Accession | NZ_CP103873 | ||
Organism | Herbaspirillum huttiense strain ZXN111 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | NY669_RS26960 | Protein ID | WP_259435364.1 |
Coordinates | 63053..63349 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | NY669_RS26955 | Protein ID | WP_259435363.1 |
Coordinates | 62649..63050 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY669_RS26930 (NY669_26930) | 58313..59110 | - | 798 | WP_259435359.1 | N-6 DNA methylase | - |
NY669_RS26935 (NY669_26935) | 59123..59374 | - | 252 | WP_259435440.1 | plasmid related protein | - |
NY669_RS26940 (NY669_26940) | 59823..60047 | - | 225 | WP_259435360.1 | hypothetical protein | - |
NY669_RS26945 (NY669_26945) | 60044..60496 | - | 453 | WP_259435361.1 | single-stranded DNA-binding protein | - |
NY669_RS26950 (NY669_26950) | 61058..61222 | - | 165 | WP_259435362.1 | hypothetical protein | - |
NY669_RS26955 (NY669_26955) | 62649..63050 | - | 402 | WP_259435363.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
NY669_RS26960 (NY669_26960) | 63053..63349 | - | 297 | WP_259435364.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
NY669_RS26965 (NY669_26965) | 63468..65384 | - | 1917 | WP_259435365.1 | hypothetical protein | - |
NY669_RS26970 (NY669_26970) | 66114..66503 | + | 390 | WP_259435366.1 | hypothetical protein | - |
NY669_RS26975 (NY669_26975) | 66894..67082 | + | 189 | WP_259435367.1 | hypothetical protein | - |
NY669_RS26980 (NY669_26980) | 67163..67360 | + | 198 | WP_259435368.1 | hypothetical protein | - |
NY669_RS26985 (NY669_26985) | 67420..67578 | + | 159 | WP_259435369.1 | hypothetical protein | - |
NY669_RS26990 (NY669_26990) | 67645..67998 | + | 354 | WP_259435370.1 | hypothetical protein | - |
NY669_RS26995 (NY669_26995) | 68062..68271 | + | 210 | WP_259435371.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..89029 | 89029 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10703.35 Da Isoelectric Point: 6.4739
>T256881 WP_259435364.1 NZ_CP103873:c63349-63053 [Herbaspirillum huttiense]
MEKHTPHCKLAVVKTLIAAGRVRSTQSARAGADALGLDFSGMVDVVLALTPADFYKSMTTHADHTVWQDVYRPSIDAGDV
YLKLTVIDDVLIVSFKEL
MEKHTPHCKLAVVKTLIAAGRVRSTQSARAGADALGLDFSGMVDVVLALTPADFYKSMTTHADHTVWQDVYRPSIDAGDV
YLKLTVIDDVLIVSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14773.08 Da Isoelectric Point: 7.6665
>AT256881 WP_259435363.1 NZ_CP103873:c63050-62649 [Herbaspirillum huttiense]
MKCPVCGAAELIHDTRDLPYIYKGESTVIAAVTGDYCPACAESILDAAESERVMREMRAFSKQVNAAIVDPVYITTVRKK
LRLDQREAAEIFGGGINAFSRYENGKTKPPLSLVKLFKLLDRHPDLLNEVRTA
MKCPVCGAAELIHDTRDLPYIYKGESTVIAAVTGDYCPACAESILDAAESERVMREMRAFSKQVNAAIVDPVYITTVRKK
LRLDQREAAEIFGGGINAFSRYENGKTKPPLSLVKLFKLLDRHPDLLNEVRTA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|