Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2458804..2459412 | Replicon | chromosome |
| Accession | NZ_CP103872 | ||
| Organism | Herbaspirillum huttiense strain ZXN111 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | NY669_RS11110 | Protein ID | WP_259434955.1 |
| Coordinates | 2459125..2459412 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NY669_RS11105 | Protein ID | WP_209580605.1 |
| Coordinates | 2458804..2459115 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NY669_RS11090 (NY669_11090) | 2454698..2455897 | + | 1200 | WP_034335527.1 | HDOD domain-containing protein | - |
| NY669_RS11095 (NY669_11095) | 2455903..2457975 | + | 2073 | WP_259435274.1 | EAL domain-containing protein | - |
| NY669_RS11100 (NY669_11100) | 2458235..2458771 | + | 537 | WP_034335522.1 | superoxide dismutase family protein | - |
| NY669_RS11105 (NY669_11105) | 2458804..2459115 | - | 312 | WP_209580605.1 | HigA family addiction module antitoxin | Antitoxin |
| NY669_RS11110 (NY669_11110) | 2459125..2459412 | - | 288 | WP_259434955.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NY669_RS11120 (NY669_11120) | 2459872..2461125 | - | 1254 | WP_259434956.1 | aspartate kinase | - |
| NY669_RS11125 (NY669_11125) | 2461655..2461933 | - | 279 | WP_034329281.1 | DUF4148 domain-containing protein | - |
| NY669_RS11130 (NY669_11130) | 2462183..2463094 | + | 912 | WP_259434957.1 | LysR family transcriptional regulator | - |
| NY669_RS11135 (NY669_11135) | 2463132..2463560 | - | 429 | WP_034329278.1 | thioredoxin family protein | - |
| NY669_RS11140 (NY669_11140) | 2463672..2464391 | + | 720 | WP_259434958.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10769.36 Da Isoelectric Point: 9.3928
>T256877 WP_259434955.1 NZ_CP103872:c2459412-2459125 [Herbaspirillum huttiense]
MILSFRCADTEALFHGKSVPRFANIRAAAERKLQMLDAAATLEFLRTPPGNRLESLHGNRDGQHSIRINGQFRLCFIWHS
IGRIGASHVEIIDYH
MILSFRCADTEALFHGKSVPRFANIRAAAERKLQMLDAAATLEFLRTPPGNRLESLHGNRDGQHSIRINGQFRLCFIWHS
IGRIGASHVEIIDYH
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|