Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 7025297..7025973 | Replicon | chromosome |
| Accession | NZ_CP103871 | ||
| Organism | Actinacidiphila bryophytorum strain DS3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NYE86_RS30190 | Protein ID | WP_259441735.1 |
| Coordinates | 7025611..7025973 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NYE86_RS30185 | Protein ID | WP_205044395.1 |
| Coordinates | 7025297..7025614 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYE86_RS30170 (NYE86_30170) | 7021420..7023234 | + | 1815 | WP_259441732.1 | asparagine synthase (glutamine-hydrolyzing) | - |
| NYE86_RS30175 (NYE86_30175) | 7023231..7023956 | + | 726 | WP_259441733.1 | tyrosine-protein phosphatase | - |
| NYE86_RS30180 (NYE86_30180) | 7024443..7025168 | + | 726 | WP_259441734.1 | response regulator transcription factor | - |
| NYE86_RS30185 (NYE86_30185) | 7025297..7025614 | - | 318 | WP_205044395.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NYE86_RS30190 (NYE86_30190) | 7025611..7025973 | - | 363 | WP_259441735.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYE86_RS30195 (NYE86_30195) | 7026114..7026470 | + | 357 | WP_259441736.1 | YciI family protein | - |
| NYE86_RS30200 (NYE86_30200) | 7026613..7027868 | + | 1256 | Protein_5961 | RNA polymerase subunit sigma-24 | - |
| NYE86_RS30205 (NYE86_30205) | 7028055..7028726 | + | 672 | WP_259441737.1 | ABC transporter ATP-binding protein | - |
| NYE86_RS30210 (NYE86_30210) | 7028738..7029166 | + | 429 | WP_259441738.1 | S26 family signal peptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13309.99 Da Isoelectric Point: 4.5951
>T256874 WP_259441735.1 NZ_CP103871:c7025973-7025611 [Actinacidiphila bryophytorum]
VSGEWDIYLVDEVRDWIGGLDDAAHARVVQALDALAEGGPGLGRPLVDTIHGSVMANLKELRPGSVRILFAFDPWRSSIL
LVAGDKAGQWNEWYREAVPLAEQRYEMYVRERTKTEGAGS
VSGEWDIYLVDEVRDWIGGLDDAAHARVVQALDALAEGGPGLGRPLVDTIHGSVMANLKELRPGSVRILFAFDPWRSSIL
LVAGDKAGQWNEWYREAVPLAEQRYEMYVRERTKTEGAGS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|