Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | paaR-paaA-parE/- |
| Location | 5008420..5008891 | Replicon | chromosome |
| Accession | NZ_CP103864 | ||
| Organism | Escherichia coli O157:H7 strain RV06 | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | A0A0D7C2L1 |
| Locus tag | NUE47_RS24815 | Protein ID | WP_001303511.1 |
| Coordinates | 5008613..5008891 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | paaA | Uniprot ID | Q8XAD5 |
| Locus tag | NUE47_RS24810 | Protein ID | WP_001302048.1 |
| Coordinates | 5008420..5008611 (+) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE47_RS24770 (5003627) | 5003627..5004211 | - | 585 | WP_000206793.1 | DUF551 domain-containing protein | - |
| NUE47_RS24775 (5004268) | 5004268..5004663 | - | 396 | WP_001118159.1 | DUF977 family protein | - |
| NUE47_RS24780 (5004679) | 5004679..5005448 | - | 770 | Protein_4830 | DUF1627 domain-containing protein | - |
| NUE47_RS24785 (5005474) | 5005474..5006214 | - | 741 | WP_000788938.1 | ATP-binding protein | - |
| NUE47_RS24790 (5006221) | 5006221..5007183 | - | 963 | WP_000095669.1 | helix-turn-helix domain-containing protein | - |
| NUE47_RS24795 (5007206) | 5007206..5007631 | - | 426 | WP_000693943.1 | toxin YdaT family protein | - |
| NUE47_RS24800 (5007628) | 5007628..5007930 | - | 303 | WP_000172738.1 | transcriptional regulator | - |
| NUE47_RS24805 (5008028) | 5008028..5008399 | + | 372 | WP_001169686.1 | hypothetical protein | - |
| NUE47_RS24810 (5008420) | 5008420..5008611 | + | 192 | WP_001302048.1 | hypothetical protein | Antitoxin |
| NUE47_RS24815 (5008613) | 5008613..5008891 | + | 279 | WP_001303511.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUE47_RS24820 (5009244) | 5009244..5009543 | + | 300 | WP_001240334.1 | hypothetical protein | - |
| NUE47_RS24825 (5009615) | 5009615..5009833 | + | 219 | WP_001171930.1 | protein YdfC | - |
| NUE47_RS24830 (5010402) | 5010402..5010590 | + | 189 | WP_000449192.1 | cell division inhibition protein DicB | - |
| NUE47_RS24835 (5010587) | 5010587..5010778 | + | 192 | WP_001090200.1 | DUF1482 family protein | - |
| NUE47_RS24840 (5010871) | 5010871..5013342 | + | 2472 | WP_000048458.1 | exonuclease | - |
| NUE47_RS24845 (5013415) | 5013415..5013666 | + | 252 | WP_000005552.1 | excisionase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 4971060..5023771 | 52711 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10661.25 Da Isoelectric Point: 5.5647
>T256864 WP_001303511.1 NZ_CP103864:5008613-5008891 [Escherichia coli O157:H7]
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|