Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3062022..3062716 | Replicon | chromosome |
Accession | NZ_CP103864 | ||
Organism | Escherichia coli O157:H7 strain RV06 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | C3TNX7 |
Locus tag | NUE47_RS14695 | Protein ID | WP_001263495.1 |
Coordinates | 3062318..3062716 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | NUE47_RS14690 | Protein ID | WP_000554757.1 |
Coordinates | 3062022..3062315 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUE47_RS14670 (3057733) | 3057733..3058230 | + | 498 | Protein_2846 | REP-associated tyrosine transposase RayT | - |
NUE47_RS14675 (3058375) | 3058375..3060087 | - | 1713 | Protein_2847 | flagellar biosynthesis protein FlhA | - |
NUE47_RS14680 (3060059) | 3060059..3060844 | + | 786 | WP_000207556.1 | putative lateral flagellar export/assembly protein LafU | - |
NUE47_RS14685 (3060915) | 3060915..3061970 | + | 1056 | WP_001226188.1 | DNA polymerase IV | - |
NUE47_RS14690 (3062022) | 3062022..3062315 | + | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NUE47_RS14695 (3062318) | 3062318..3062716 | + | 399 | WP_001263495.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
NUE47_RS14700 (3062726) | 3062726..3063178 | + | 453 | WP_001059871.1 | GNAT family N-acetyltransferase | - |
NUE47_RS14705 (3063497) | 3063497..3063700 | + | 204 | Protein_2853 | RtcB family protein | - |
NUE47_RS14710 (3063699) | 3063699..3064220 | + | 522 | Protein_2854 | peptide chain release factor H | - |
NUE47_RS14715 (3064277) | 3064277..3065734 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
NUE47_RS14720 (3065995) | 3065995..3066453 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (3067049) | 3067049..3067129 | + | 81 | NuclAT_12 | - | - |
- (3067049) | 3067049..3067129 | + | 81 | NuclAT_12 | - | - |
- (3067049) | 3067049..3067129 | + | 81 | NuclAT_12 | - | - |
- (3067049) | 3067049..3067129 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15473.86 Da Isoelectric Point: 8.0949
>T256858 WP_001263495.1 NZ_CP103864:3062318-3062716 [Escherichia coli O157:H7]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|